KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_2811Help
Entry
BT_2811           CDS       T00122                                 

Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Brite
KEGG Orthology (KO) [BR:bth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BT_2811
Enzymes [BR:bth01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BT_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored HI0933_like FAD_binding_2 Thioredoxin_3 Thi4 AlaDh_PNT_C DAO NAD_binding_7 NAD_binding_8 FAD_binding_3 PALP Glutaredoxin Lycopene_cycl PLD_C K_oxygenase
Motif
Other DBs
NCBI-GeneID: 1072130
NCBI-ProteinID: NP_811723
UniProt: Q8A3Z3
LinkDB All DBs
Position
complement(3491839..3493410)
Genome map
AA seq 523 aa AA seqDB search
MKGEREMLEPALKEQLKGIFAGLEADFTFDISVSASHESRAELLELLSDVAECSDHITCM
VNEGSGLKFTIGKNGKPTEITFRAIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKAL
KGPIHLVTYVSLTCTNCPDVVQALNAMTTLNPSITHEMVDGALYQDEVDALKIQGVPSVF
ADGKLLHVGRGEFGELLAKLEAQYGIDETKVETEVKEYDVIVAGGGPAGVSAAIYSARKG
LRVAIVAERVGGQVKETVGIENLISVPETTGSELADNLKTHLLRYPVDLLEQRKIEKVEL
AGKDKLVTTSVGEKFIAPALIIATGASWRKLNVPGENDYIGRGVAFCPHCDGPFYKGKQV
AVVGGGNSGIEAAIDLAGICSKVTVFEFMDELKADNVLQERLKSLPNVEVFVSSQTTEVI
GNGDKLTALRIKDRKTEEERLVELDGVFVQIGLSANSSVFRDIVETNRPGEIVIDAHCRT
NVTGIYAAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGLIV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagaaagagagatgttagaacctgcattaaaagaacaactgaagggtattttt
gccggactggaggctgactttacctttgatatatccgtatcagccagtcatgaaagccgt
gccgaattgctggaattgctgagcgatgtagccgaatgttccgatcacatcacttgtatg
gtaaatgaaggaagcggacttaaatttacgataggaaagaatggtaaacctacagaaatt
actttccgtgctatccccaacggacatgagtttacttctttattactcgccatcctgaat
ctggacggtaagggaaagaattttccggatgaggctgtctgcaaccgtgtgaaagccttg
aagggtccgatacacttagtgacctatgtctcactgacttgcaccaactgtccggatgta
gttcaggcattgaatgcaatgaccacactgaatccttccattactcatgaaatggttgac
ggtgcactgtatcaggatgaagtggatgccttgaagatacaaggcgtgccttctgtattt
gccgatgggaaactgcttcatgtaggtcgtggcgaatttggcgaattgcttgctaaactg
gaagcgcaatacggtattgatgaaaccaaggtggagacggaagtgaaggaatacgatgtt
atcgtagccggtggcggtcctgccggagtatcagcagccatctattctgcccgtaaaggc
ttgcgcgtggcgattgttgccgagcgtgtcggcggacaggtgaaagagacggtaggcatt
gagaatctgatttcggttcccgaaacaacaggaagcgaacttgccgataatctgaaaacg
catcttctgcgttatcctgttgatttgttggaacagcgtaagatagaaaaggtagaactt
gccggaaaagataaactggtaactacttccgtaggagagaaattcattgctcctgcattg
attatcgctacaggtgcaagctggcgaaaactgaatgttcccggcgagaacgattatatc
gggcgtggagtcgctttctgtcctcattgcgacggtcctttctataaaggaaagcaggtt
gcggtagtgggcggtggaaactccggcatcgaggcagccattgacttggcaggtatctgt
tctaaagtcaccgtctttgaatttatggatgaactgaaagcggataatgtccttcaggaa
agacttaaatctctgccgaatgtggaagtattcgtgagttcgcaaacgacagaagtaatt
ggtaatggcgataaactgacagccttgcgcatcaaagaccgtaagacggaagaagaacgt
ttggtagaactggacggagtattcgtgcagatcggactttccgccaatagcagcgttttc
cgtgatattgtggaaacaaaccgaccgggtgaaatcgttatcgatgcgcattgccgtacc
aatgtgacgggaatctatgcagccggagacgtatcgaccgtaccttacaaacagattatt
atttctatgggcgaaggtgccaaagccgccctttctgcctttgatgaccgcgtgcggggg
ctgattgtataa

DBGET integrated database retrieval system