KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_3356Help
Entry
BT_3356           CDS       T00122                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00010  Glycolysis / Gluconeogenesis
bth00030  Pentose phosphate pathway
bth00051  Fructose and mannose metabolism
bth00052  Galactose metabolism
bth00680  Methane metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_3356 (pfkA)
   00030 Pentose phosphate pathway
    BT_3356 (pfkA)
   00051 Fructose and mannose metabolism
    BT_3356 (pfkA)
   00052 Galactose metabolism
    BT_3356 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BT_3356 (pfkA)
Enzymes [BR:bth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BT_3356 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BT_3356 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 1072122
NCBI-ProteinID: NP_812268
UniProt: Q8A2E9
LinkDB All DBs
Position
4330831..4331841
Genome map
AA seq 336 aa AA seqDB search
MRIGILTSGGDCPGINATIRGVCKTAINHYGMEVIGIHSGFQGLLTKDIESFTDKSLSGL
LNQGGTMLGTSREKPFKKGGVVSDVDKPALILQNIQEMGLDCVVCIGGNGTQKTAAKFAA
MGVNIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAG
WIALYSGMAGGGDVILVPEIPYNIKNIGNTILERLKKGKPYSIVVVAEGILTDGRKRAAE
YIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIANGQFGRMIALKG
DDISSIPLEEVAGKLKLVTEDHDLVIQGRRMGICFG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggaatcctgacttccggaggagactgccccggtataaatgccactatccgt
ggcgtgtgcaaaactgccatcaatcactatgggatggaagtaataggaattcatagtggt
tttcaaggtttgctgacaaaagacatcgaatcctttactgataaatccttatccggattg
ttgaaccaagggggtacaatgctgggtacttcgcgcgagaaaccttttaaaaaaggaggc
gtcgtctcggatgtcgacaagccggcactgattcttcagaatattcaggaaatgggactg
gattgtgtcgtctgcatcggaggaaacggaacgcagaaaactgccgctaaatttgccgca
atgggcgtcaacatcgtatcggtccccaaaaccattgataatgatatttggggaacggat
atttcctttggatttgactccgccgtgagcatcgctacggatgccatcgaccgcttgcat
tctaccgccagctcgcacaaaagggtgatggttattgaagtgatggggcataaagccggc
tggattgccctgtattcgggcatggcgggtggcggcgacgtcattcttgtccccgaaatc
ccttacaacatcaagaatataggaaatacaatcctcgaaaggctgaaaaaaggcaaaccc
tattccatcgtagtggtggcagaaggcatcctgacggatggccggaaacgtgccgcggaa
tacatcgcacaggaaatagaatatgaaacgggcatcgaaacacgtgaaaccgtattggga
tatattcagcgtggcggttcgcctactcctttcgaccgtaacctgtctacccgcatggga
ggacacgcgacagaattgattgccaatggacaattcggacgtatgattgccttaaaagga
gatgacatttcgtctatccctcttgaagaagttgccggtaaattgaagttggtaactgaa
gatcacgatttagtgattcagggccgccgcatggggatttgtttcggttaa

DBGET integrated database retrieval system