KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_3713Help
Entry
BT_3713           CDS       T00122                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00473  D-Alanine metabolism
bth00550  Peptidoglycan biosynthesis
bth01100  Metabolic pathways
bth01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BT_3713 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BT_3713 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BT_3713 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bth01011]
    BT_3713 (ddl)
Enzymes [BR:bth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BT_3713 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bth01011]
 Precursor biosynthesis
  Amino acid ligase
   BT_3713 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_ST RimK GARS_A TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-GeneID: 1072146
NCBI-ProteinID: NP_812624
UniProt: Q8A1F3
LinkDB All DBs
Position
4823235..4824209
Genome map
AA seq 324 aa AA seqDB search
MKRTIAIVAGGDTSEFHVSLRSAQGIYSFIDKEKYTLYIVEMQGTRWEVQLPDGAKAPVD
RNDFSFMLGTEKIRFDFAYITIHGTPGEDGRLQGYFDMMHIPYSCCGVLAAAITYDKFTC
NQYLKAFGVRIAESLLLRQGQSVSDEDVMEKIGLPCFIKPSLGGSSFGVTKVKTKEQIQP
AIVKAFEEAQEVLVEAFMEGTELTCGCYKTKDKTVIFPPTEVVTHNEFFDYDAKYNGQVD
EITPARISDELTNRVQMLTSAIYDILGCSGIIRVDYIVTAGEKINLLEVNTTPGMTTTSF
IPQQVRAAGLDIKDVMTDIIENKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacaattgctatcgtagccggaggtgacacctccgaatttcatgtatccctg
cgtagtgcacagggaatatattccttcatagataaggaaaagtacacactgtacattgtc
gagatgcaggggacccgttgggaagtacaattgccggatggtgcaaaagcaccggtagac
cgcaatgatttcagctttatgctgggaacggaaaagatcaggtttgactttgcctatatt
accattcacggtactccgggcgaagacggccgtcttcagggatactttgacatgatgcac
ataccatactcttgttgcggggtgctggctgcggcgatcacctatgacaagtttacctgc
aaccaatacctgaaagccttcggagtgcgtattgcagaatcgttgctattgcgtcaggga
caatcggtttccgacgaagatgtgatggaaaagatcggtttgccttgtttcatcaagccg
agtctgggcggttcgagcttcggtgtaacaaaggttaagacgaaagaacaaatacagccg
gccattgttaaggcctttgaagaagcccaggaagtgctcgtagaagcattcatggaagga
acggagctaacctgcggctgctataaaaccaaagacaagaccgtcatcttcccgcctacg
gaagtggtgacacataatgagttctttgattatgatgcaaaatacaatggtcaggtagac
gagattactcctgcacgcatctcggacgaactgacgaatcgcgtgcaaatgctgacctcg
gccatttatgacatattgggctgttccggtatcatccgtgtggattatattgtgactgcc
ggcgaaaagatcaatctgctggaagtgaatacaactccggggatgaccactacaagcttt
attccccagcaagtgcgtgctgccggactggatataaaggatgtgatgactgatataata
gaaaataaattttag

DBGET integrated database retrieval system