KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_4101Help
Entry
BT_4101           CDS       T00122                                 

Definition
(RefSeq) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00473  D-Alanine metabolism
bth01100  Metabolic pathways
bth01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BT_4101
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BT_4101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bth01011]
    BT_4101
Enzymes [BR:bth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BT_4101
Peptidoglycan biosynthesis and degradation proteins [BR:bth01011]
 Precursor biosynthesis
  Racemase
   BT_4101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 1073556
NCBI-ProteinID: NP_813012
UniProt: Q8A0C0
LinkDB All DBs
Position
5359608..5362157
Genome map
AA seq 849 aa AA seqDB search
MSYTIESIAEYIGARRVGEHEATIDWLLTDSRSLSFPEETLFFALPTKRNNGARYISELY
DRGVRNFVVTEEDFKRMENGEWKMENAMQQDGAQPTPNSRLSILDFSNFLIVANPLKALQ
KLAEAHRENFKIPVIGITGSNGKTIVKEWLHQLLSPDRCIVRSPRSYNSQIGVPLSVWQL
NEEAELGIFEAGISEMGEMGALKRMIKPTIGILTNIGGAHQENFFSLQEKCMEKLTLFKD
CDVVIYNGDNELISNCVAKSMLTAREIAWSCKDIERPLYISKVTKKEDHTVIAYRYLDMD
NIFCIPFIDDASIENALNCLAACLYLMTPADQITERMARLEPIAMRLEVKEGKNNCILIN
DSYNSDLASLDIALDFLVRRSEKKGLKRTLILSDILETGQSTATLYRRVAQLIKSRGINK
LIGVGAEISSCAARFEGTPERYFFPDTDALLRSGIFKTLHSEVILIKGSRVFNFDLVSEE
LELKVHETILEVNLGAMVANLNHYRSMLRHPETKMICMVKAAAYGAGSYEIAKTLQEHHV
DYLAVAVADEGSELRKAGITSSIIIMDPELTSFKTMFDYKLEPEVYNFHLLDALIKAAEK
EGITNFPIHVKLDTGMHRLGFSVDEIPLLIRRLKSQNAVIPRSVFSHFVGSDSAQFDFFT
RQQIELFEKGSQELQEAFSHKILRHICNTAGIERFPGAQFDMVRLGIGLYGVSPIDNSII
NNVSTLKTTILQIRDVPGEDTVGYSRMGHLTRPSRIAAIPIGYADGLNRHLGRGNAYCLV
NGKKAPYVGNICMDVCMIDVTDIDCREGDKAVIFGDDLPITTLSDKLGTIPYEVLTSISN
RVKRVYYQD
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatacgattgaatccatagccgaatatatcggtgcacgccgtgtcggagagcat
gaagcgacgattgattggctacttacagatagccgctctttgagctttccggaagaaacc
cttttctttgctttgcccaccaaacgtaataatggtgcacgctatatctccgaactatat
gatcggggagtgcgcaacttcgtggttacggaagaagactttaagagaatggagaatgga
gaatggaaaatggagaatgctatgcagcaggatggtgcgcagcctactcccaactctcga
ctctccattctcgatttctccaatttcttgatcgtggcgaatcctttgaaggctttgcag
aagctggccgaggctcatcgggagaatttcaagattccggtaatcggtatcacgggcagt
aatggaaagaccattgtgaaagagtggttgcatcaattattgagtccggaccgctgcatt
gtccgttcgccccgcagttataattctcagatcggcgttcccttgtccgtctggcaactg
aatgaagaagccgaattgggtattttcgaagccggtatctccgaaatgggggagatgggg
gccttgaagcgcatgattaaaccgactatcggtattctgactaatataggcggtgcccat
caggagaatttcttctcattgcaggagaaatgtatggagaagctgacactctttaaagat
tgcgatgtggtgatctataatggagataacgagctgatcagtaattgtgtggcaaagtcg
atgctgacagcccgtgagattgcatggagctgcaaggatatcgagcgccctctttatatc
agcaaggtgacaaagaaagaagaccatactgtgattgcttaccgctatctggatatggat
aatatcttctgtattccttttatagacgatgcttccatcgaaaatgcgttgaactgcctg
gcagcctgtctttatctgatgactcctgccgatcagattaccgaacggatggcacggctc
gaaccgatcgccatgcgcctggaagtaaaagaaggcaagaataattgtatactcatcaac
gatagctacaattcggacttggcttctctggatatagcactggatttcctggtacgccgt
tcggaaaagaaaggactgaaacggacacttatcttatcggatattttggagacagggcag
agtacggctacgctttaccgtcgggtagcacaactgataaagagccggggcatcaacaag
ctgatcggtgtaggagcggagatttcttcgtgtgccgctcgcttcgaaggtacaccggaa
cgatacttcttccccgatacagacgccttgctaagatcgggcatttttaaaacccttcat
tcggaagtcattctgataaaaggttcccgcgtattcaactttgatctggtatcggaagag
ctggaactgaaagtgcatgaaacgattctggaagtgaacttgggtgcgatggttgccaat
ctgaatcactatcgctccatgctccgccatccggagacgaaaatgatctgtatggtgaag
gctgctgcctacggagccggatcatacgagattgccaaaacattgcaggagcatcatgta
gattaccttgctgtagccgttgccgacgaaggctccgaactgcgtaaagcaggcatcacc
tcctccattatcatcatggaccccgaactgacatcgttcaaaacgatgttcgattataaa
ctcgaaccggaagtgtacaacttccatttgctcgatgcactgattaaggcggccgagaaa
gaaggaatcaccaacttcccgattcatgtcaaactggatacgggtatgcaccgtcttggt
ttttccgtcgatgaaattccgttgttgatccgtcgtctgaaaagtcagaatgcggttatt
ccccggtcggtattctctcattttgtgggaagtgattcggcgcaattcgacttcttcacc
cgtcagcagattgaactgttcgagaaaggttcgcaggaattgcaggaagctttctcacac
aagattctgcgtcatatctgcaatacagccggtatcgaacgttttcccggtgcgcagttt
gatatggtgcgtctggggataggactctatggggtaagcccgatcgacaattcgattatc
aataatgtaagcacgcttaagactacgattcttcagattcgggacgtgcccggagaagat
acggtaggctatagccggatgggacatctgacgcgtccttcccgcattgcggcaattcct
atcgggtatgccgatggcttgaaccgccatctgggacgtggcaatgcttactgtctggtg
aatggcaagaaagctccctatgtaggaaatatctgtatggatgtctgtatgattgacgtg
acggatatcgattgcagggaaggggacaaagctgtcatcttcggtgacgacctgccgata
accacactttcggataagttggggacgatcccttacgaagtgctgaccagcatctcgaac
cgtgtgaagcgagtctactatcaggactaa

DBGET integrated database retrieval system