KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_4581Help
Entry
BT_4581           CDS       T00122                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00500  Starch and sucrose metabolism
bth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BT_4581
Enzymes [BR:bth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BT_4581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-GeneID: 1073927
NCBI-ProteinID: NP_813492
UniProt: Q89YZ9
LinkDB All DBs
Position
6001250..6003409
Genome map
AA seq 719 aa AA seqDB search
MKNMKILTTAVLCLLLSFSMGATAMAESITSPDGQLKLDFSVNVQGEPVYELTYKGKGVI
KPSKLGLELKNDPGLMNGFACIDTKTSTFDETWEPVWGEVKSIRNHYNEMAVTLNQKAQD
RNMIIRFRLYNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMTGDHTAFWIPGDYDTQEYDY
TESRLTEIRGLMKGAITDNASQTSFSPTGVQTSLQMKTADGLYINLHEAALVDYSCMHLN
LDDKKLIFESWLTPDAMGDKGYMQTPCQSPWRTVIVSDDARDILASKLTLNLNEPCAYQD
VSWIKPVKYIGVWWEMITGKSSWAYTDDVYSVKLGQTDYSKTSPNGRHAANNDKVKRYID
FAAQHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVKMLNAYAKEKGVKLMMHH
ETSASVRNYERHLDTAYQFMVDNGYNAVKSGYVGNIIPRGEHHYGQWMNNHYLYAVTKAA
DYKICVNAHEAVRPTGLCRTYPNLIGNESARGTEYEAFAGNKPFHTTLLPFTRQIGGPMD
YTPGIFDTRISFLDGKHSVVRTTLAKQLALYVTMYSPLQMAADLPESYERYPDAFQFIKD
VALDWDDSKYLEAEPGDYITVARKAKGTNHWFVGGITDENSRTAAFTLDFLEPDKEYVAT
LYADGKEADYEKNPTSYQIKKGIVTNKTKMSVKLARSGGFALSLIEAAPSDRKSIKKWK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgaaaatattaactacggcagtactctgtctgttactctctttttctatg
ggtgcaacggcaatggcagaaagtatcacttctcctgacggacaattaaaactggatttt
tcggtcaatgttcagggagaaccggtatacgaacttacttataaaggaaagggagtgatt
aaaccatcaaagttgggacttgagttgaagaatgatccgggactgatgaatgggtttgcg
tgcatcgatacaaaaacttccaccttcgacgaaacttgggagccggtgtggggagaagtg
aaatccattcgcaatcattataatgaaatggctgtcacactgaatcagaaggcgcaggac
cggaatatgatcatccgtttccggctttacaatgatggattaggtttccgctatgaattt
ccgcagcagaagaatctgaattattttgttattaaggaagaacattcgcagtttgccatg
acgggtgaccatactgccttttggattccgggagattatgatacccaggaatatgattac
acagaatccagactaacagaaatccgtggactgatgaaaggggctattaccgacaatgct
tctcaaacgtctttttcaccaacaggcgtgcagacatctctgcaaatgaaaacagccgac
ggtctgtatattaacctgcacgaagccgctttggtagattattcctgcatgcatctcaat
cttgatgacaaaaaactgatttttgaatcatggctgacaccggatgcaatgggagataaa
ggttatatgcagacaccctgtcagtctccgtggcgtacggtgattgtgagcgatgatgca
cgcgatatccttgcttccaaactgaccttgaatctgaacgaaccatgtgcttatcaagat
gtttcttggattaaaccggtgaagtatatcggtgtgtggtgggagatgattaccggaaaa
agcagttgggcatatacagatgatgtttattccgtcaaactcggacagacggattactca
aagacaagccctaacggacgtcacgctgccaacaatgacaaagtaaaacgttatatcgac
tttgcagcgcagcatggtttcgatcaggtattggtagaaggctggaatgaaggctgggaa
gattggttcggcaaatcaaaagattatgtgtttgatttcgtcactccctatccggatttc
gacgtgaagatgctaaacgcatatgccaaagagaaaggggtgaagctgatgatgcatcat
gaaacatctgcctccgtgcgtaactacgaacgccatctggatacggcctaccaatttatg
gttgacaacggatataatgccgtgaaaagtggttatgttggcaatatcattcctcggggc
gaacatcactatggacaatggatgaacaaccattatctatatgccgtgacgaaagccgcc
gattataaaatctgtgtgaatgcgcacgaagctgtacgtcctactggattatgccgtact
tatcccaacctgatcggcaatgaatcggcacgggggacggaatatgaagcttttgccggt
aataaaccttttcatactactttgcttccattcactcggcagatcggcggcccgatggat
tatacaccgggtatcttcgacacgagaatttcttttctggatgggaagcatagcgttgta
cgtactactctggcgaaacaactggctctttacgtaacaatgtacagtcctttgcagatg
gctgccgatttgccggaaagttatgagcgttatccggatgctttccagtttattaaagat
gtagccttggactgggatgacagcaaatatctggaagccgaaccgggggattatattaca
gtagcccgcaaagcaaaaggaaccaatcattggtttgttggcggtattactgacgaaaac
tcccgtactgccgcgtttactcttgattttctggaaccggataaagagtatgtggctacc
ctgtatgccgacggaaaagaggctgactacgaaaagaatccgacttcctatcagataaag
aaagggatcgttacgaataaaacaaagatgtccgtcaagctggcacgcagcggtggtttt
gcattgagtcttatcgaagcagctccatccgaccggaaatcaattaagaaatggaaatga

DBGET integrated database retrieval system