KEGG   Burkholderia thailandensis 2003015869: DR62_1124Help
Entry
DR62_1124         CDS       T03763                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00010  Glycolysis / Gluconeogenesis
btha00620  Pyruvate metabolism
btha01100  Metabolic pathways
btha01110  Biosynthesis of secondary metabolites
btha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR62_1124
   00620 Pyruvate metabolism
    DR62_1124
Enzymes [BR:btha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DR62_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AIP63976
LinkDB All DBs
Position
1:905564..907084
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPIGGEYFDNVSPVTGRPFTAIPRSREADVEL
ALDAAHAAKAGWAATDAAQRANVLLRIADRMEANLARLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAIKRVEAIKQGHPLDSQTMIGAQASSEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEAL
EIANDTQYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaatttccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccgatcggcggtgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgaagccgacgtcgagctc
gcgctcgacgccgcgcacgcggcaaaggcgggctgggccgcgacggacgcggcccagcgt
gcgaacgtgctgctgaggatcgccgatcggatggaggcaaacctcgcgcgcctcgcggtc
gccgagacgatcgacaacggcaagccgctgcgcgagacgaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gacatcggcggcgacatggtcgcctatcacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaactttccgctcctgatggccgcgtggaagctcgcgcccgcgctcgcg
gccggcaactgcgtcgtgctcaagcccgccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggc
ctcgaagcgggcaagccgctcgcgtcgagcaagcggatcgcgaagatcgcgttcacggga
gagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctgattcccgtcacg
ctcgagctcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgcacgtgcccgtcgcgcgcgctcgtcgaggagagcatctacgagcgcttcatcgagcgt
gcgatcaagcgcgtcgaggcgatcaagcaaggccatccgctcgattcgcagacgatgatc
ggcgcgcaggcgtcgtccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgaaggcgcgcaatgcctgacgggcggcgagcgcaacgtgctcggcggcgaactcgcc
gaaggctactacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagagatcttcgggccggtgctcgcggtgacgacgttcaagaccgaagaggaagcgctc
gagatcgcgaacgacacgcagtacggcctgggcgcgggcgtctggacgcgcgacggcaac
cgcgcgtaccgcttcggccgcggcatccaggcgggccgcgtgtggaccaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcaatcgggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system