KEGG   Burkholderia thailandensis 2003015869: DR62_1574Help
Entry
DR62_1574         CDS       T03763                                 

Definition
(GenBank) cytochrome C550
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00550  Peptidoglycan biosynthesis
btha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DR62_1574
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btha01002]
    DR62_1574
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btha01011]
    DR62_1574
Enzymes [BR:btha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DR62_1574
Peptidases [BR:btha01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DR62_1574
Peptidoglycan biosynthesis and degradation proteins [BR:btha01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DR62_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AIP61882
LinkDB All DBs
Position
1:1400963..1402273
Genome map
AA seq 436 aa AA seqDB search
MRLSSLGLTSLASSTAIAVAARNVALGIVLPAALVSTIAVAQAKPAAKAKHAAAPAAAAP
TGAPATYAPGAVPPPGVNARSWVLVDASSNQVLASGNADERVEPASLTKLMTAYLVFEAL
DSKKITMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALAELV
GGSEAQFVNMMNAQAQRLGMTHTHFADVNGMPDPNHYTTAGDLATLSTHLIRDYPDYYNI
FSVKEFTYNNIKQPNRNRLLWLDPTVDGLKTGHTQAAGYCLIASAKRSLPGAADATRRLV
TVMMGETKESDRVQDSMKMLNYGYTAFDSVRLYKAGQPIDTPRVYKGKSNNVQVGVKKDQ
FITVPRGLADKVKPEVALNAPLIAPLADGQAVGSVKLVADGKTVAEFPVVALQPVPEAGL
LGRIWDSILLMFSKKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtcttccctcggcctcacgtcactcgcttcctccaccgccattgccgtcgcc
gcgcgcaacgtcgcgctcggcatcgtgctgcccgccgcgctcgtgtcgacgatcgccgtc
gcgcaggcgaagcccgccgccaaggcgaagcacgcggccgcgccggccgccgccgcgccg
acgggcgcgcccgccacttatgcgccgggcgccgtgccgccgccgggcgtgaacgcgcgc
tcgtgggtgctcgtcgacgcgtcgagcaaccaggtgctcgcatccggcaacgcggacgag
cgcgtcgagccggcgtcgctcacgaagctgatgacggcctacctcgtgttcgaggcgctc
gactcgaagaagatcacgatggagcagatcgtcacgccgagcgaggcagtgcgccgcgtc
ggccgcgacgagtcgcggatgttcatcgaggcgaacaagcccgtcagcgttcacgatctc
gtctacgggatgatcatccagtcgggcaacgacgcggcgatcgcgctcgccgagctcgtc
ggcggcagcgaggcgcagttcgtcaacatgatgaacgcgcaggcgcagcgcctcggtatg
acgcacacgcacttcgccgacgtgaacgggatgcccgacccgaaccactacacgacggcg
ggcgacctcgcgacgctgtcgacgcacctgatccgcgactatccggattactacaacatc
ttctcggtcaaggaattcacgtacaacaacatcaagcagccgaaccgcaaccggctgctg
tggctcgatccgaccgtcgacggcctgaagaccggccacacgcaggcggccgggtactgc
ctgatcgcgtcggcgaagcgttcgctgccgggcgcggccgatgcgacgcgccgcctcgtc
acggtgatgatgggcgagacgaaggagagcgaccgcgtgcaggacagcatgaagatgctg
aactacggctacaccgcgtttgattcggtgcgcctgtacaaggccggccagccgatcgac
acgccgcgcgtctataagggcaagagcaacaacgtgcaggtcggcgtgaagaaggaccag
ttcatcaccgtgccgcgcggcctggcggacaaggtgaagccggaagttgcgctgaacgcg
ccgctcatcgcgccgctcgcggacggccaggcggtcggctcggtgaagctcgtcgccgac
ggcaagacggttgcggaattcccggtcgtcgcgctgcagccggtgcccgaggcgggcctg
ctcggccgcatctgggattcgatcctgctgatgttcagcaaaaagaagtaa

DBGET integrated database retrieval system