KEGG   Burkholderia thailandensis 2003015869: DR62_1798Help
Entry
DR62_1798         CDS       T03763                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00564  Glycerophospholipid metabolism
btha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DR62_1798
Enzymes [BR:btha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DR62_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AIP62524
LinkDB All DBs
Position
1:complement(1666770..1668302)
Genome map
AA seq 510 aa AA seqDB search
MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLE
YKEFGLVRKALQERETLLRAAPHIIWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNALDAQERGARILTRTKLVS
AERRDGQWHARLQRADGSTLDVCARAVANAAGPWVGDVLHGALGRGAQHSVRLVKGSHIV
TRRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYRDDPSRVAIDRDETRYLCES
INRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDYRLELDGGDGAPLLSVFGGKI
TTFRKLAEEATDMLGGALGASRGAWTAGVPLPGGDIADARFAPFAEAFAKRHPWLPAALA
RRYARAYGTRAERVIGGAKSLAELGAELSPGLYEAELRYLRDAEWASCADDVLWRRSKLG
LHVAPGTLDAVTAALDAWFGAAREAASAAH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaacagaatcgttacgatctgctcgtcgtcggcggcgggatcaacggcgcgggc
atcgcgcgcgacgcggccggccggggcctgtcggtgctcctttgcgaacaggacgacctc
gcgtcgcacacctcctcttcgagcacgaagctgatccacggcggtctgcgctacctcgaa
tacaaggaattcgggctcgtgcgcaaggcattgcaggagcgcgagacgctcctgcgcgcg
gcgccgcacatcatctggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccc
gcgtggctcatccggatcggcctcttcctgtacgaccatctcgcgaagcgcgagctgctg
cccggctcgcgcggcatcgacatgcgccgccacccggcgggcgcgccgctcgtcgattcg
atcaagcgcggcttcgtctactcggacggctgggtcgacgacgcgcggctcgtcgtgctg
aacgcgctcgacgcgcaggagcgcggcgcgcgcatcctcacgcgcacgaagctcgtgtcg
gccgagcgccgcgacgggcaatggcatgcgcggctgcaacgcgccgacggctcgacgctc
gacgtgtgcgcccgcgcggtcgcgaacgcggcgggcccgtgggtcggcgacgtgctgcac
ggcgcgctcggccgcggcgcacagcacagcgtgcggctcgtgaagggcagccacatcgtc
acgcggcgcctgttcgatcacgaccacgcatacatcttccagaatccggacaagcggatc
atcttcgcgattccgtacgaacgcgacttcacgctgatcggcacgaccgacgtcgaatat
cgcgacgatccgtcgcgcgtcgcgatcgaccgcgacgaaacgcgctacctgtgcgagtcg
atcaatcgctatttcaagcgtaagatctcgcccgccgacgtgtgctggacctattccggc
gtgcgcccgctcctcgaggacgagaacgcggacaacccgtccgccgtcacgcgcgactat
cgcctcgagctcgacggcggcgacggcgcgccgctcttgtcggtgttcggcggcaagatc
acgacgtttcgcaagctcgccgaagaggcgaccgacatgctgggcggcgcgctcggcgcg
tcgcgcggcgcatggacggcgggcgtgcccctgcccggcggcgacatcgccgatgcgcgt
ttcgcgccgttcgccgaagcgttcgcgaaacgtcacccgtggctgcccgccgcgctcgcg
cgccgctatgcgcgcgcgtacggcacgcgcgccgagcgcgtgatcggcggtgcgaagtcg
ctcgccgagctcggcgccgaactctcgcccggcctctacgaagcggaattgcgttatctg
cgcgacgccgaatgggcgagctgcgcggacgacgtactgtggcggcgctcgaagctcggc
ctgcatgtcgcgccgggcacgctcgacgccgtgacggccgcgctcgacgcctggttcggc
gccgcgcgcgaggcggcgagcgccgcacactga

DBGET integrated database retrieval system