KEGG   Burkholderia thailandensis 2003015869: DR62_1867Help
Entry
DR62_1867         CDS       T03763                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DR62_1867
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:btha01002]
    DR62_1867
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btha01011]
    DR62_1867
Enzymes [BR:btha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DR62_1867
   3.4.21  Serine endopeptidases
    3.4.21.-  
     DR62_1867
Peptidases and inhibitors [BR:btha01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   DR62_1867
Peptidoglycan biosynthesis and degradation proteins [BR:btha01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DR62_1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AIP62228
LinkDB All DBs
Position
1:complement(1754157..1755695)
Genome map
AA seq 512 aa AA seqDB search
MNHNAARIAASPRQARPAARMPLALLRGAMLVAACAALAFAAPADARRKPKPPRYPAAVS
AARNVLPASVLVALQRARVPASSLSVVVERIGDPTPVVAWNASRPMQPASTMKLVTTYAG
LSLLGADYRWRTSAYADGGVDENGTLHGTLYVKGTGDPKLVPEELIDLVNKIRRAGIVNV
DGALVLDKTFFAPETRDLPPLDDDASAPYNVGPDPLLYAFKALSFTVTPTDNGAVAVDVV
PPLANLTVDNQLVEGQGSCGAARPTLVTDASGGLTASFAGDYPPSCGPTTTNLAVLNHSA
FFARGFLALWRQTGGSFSGTISEGKVPGRARPVASHHGPVLSSVVHDINKFSNNVMARNL
FLTIGAVEHRPPATPAQSADTIRAFLAHSGLPTDGLTLENGSGLSRDERVSALSLADMLQ
AANASPVAQAFVDSLPIAGVDGTMKNRLTNAPVGGNAHIKTGTLRDVRAIAGYVASADGS
SYVVVSFINDDRASAARAAHDALLEWVYEGPR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacaacgccgcccgcatcgccgcctcgccacgtcaggcccgtcccgccgcccgc
atgccgctcgcgctcctgcgcggcgcgatgctcgtcgccgcgtgcgccgcgctcgcgttc
gccgcgcccgccgacgctcgccgaaagccgaagccgccgcgctaccccgccgccgtgtcg
gccgcgcgcaacgtgctgcccgcgtcggtgctcgtcgcgctgcagcgcgcgcgcgtgccg
gcgtcgagcctgagcgtcgtcgtcgagcggatcggcgaccccacgcccgtcgtcgcgtgg
aacgcgagccggccgatgcagcccgcatcgacgatgaagctcgtgacgacctacgcgggg
ctgtcgctgctcggcgccgactatcgctggcgcacgagcgcgtacgcggacggcggcgtc
gacgagaacggcacgctgcacggcacgctgtacgtgaagggcacgggcgatccgaagctc
gtgcccgaggaactgatcgacctcgtcaacaagatccgccgcgcgggaatcgtcaacgtc
gacggcgcgctcgtgctcgacaagaccttcttcgcgcccgagacgcgcgacctgccgccc
ctcgacgacgacgcgagcgcgccttacaacgtcggccccgatccgcttctctacgcgttc
aaggcgctgtcgttcacggtgacgccgaccgacaacggcgcggtcgcagtcgacgtcgtg
ccgccgctcgcgaacctgaccgtcgacaaccagttggtcgaaggccagggctcgtgcggc
gccgcgcgcccgacgctcgtgaccgacgcgagcggcgggctcaccgcgtcgttcgcgggc
gactatccgccgagctgcggcccgacgacgaccaacctcgcggtgctgaaccattccgcg
ttcttcgcgcgcggcttcctcgcgctgtggcgccagacgggcggctcgttctcgggcacg
atctccgaaggcaaggtgccgggccgcgcgcggcccgttgcgtcgcaccacggcccggtg
ctgtcgagcgtcgtgcacgacatcaacaagttcagcaacaacgtgatggcgcgcaacctg
ttcctcacgatcggcgcggtcgagcaccggccgcccgcgacacccgcgcagtcggcggac
acgatccgcgcgttcctcgcgcacagcgggctgccgaccgacggcctcacgctcgagaac
ggctcggggctctcgcgcgacgaacgcgtgagcgcgctgtcgctcgccgacatgctgcag
gcggcgaacgcgagccccgtcgcgcaggcgttcgtcgattcgctgccgatcgcgggcgtc
gacggcacgatgaagaaccggctgacgaacgcccccgtcggcggcaacgcgcacatcaag
acgggcacgctgcgcgacgtgcgcgcgatcgcgggctacgtcgcgtcggcggacgggtcg
agctatgtcgtcgtcagcttcatcaacgacgaccgcgcatcggccgcgcgcgcggcgcac
gacgcgctgctcgaatgggtgtacgaagggccgcgctga

DBGET integrated database retrieval system