KEGG   Burkholderia thailandensis 2003015869: DR62_4364Help
Entry
DR62_4364         CDS       T03763                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00440  Phosphonate and phosphinate metabolism
btha01100  Metabolic pathways
btha01120  Microbial metabolism in diverse environments
btha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DR62_4364
Enzymes [BR:btha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DR62_4364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Motif
Other DBs
NCBI-ProteinID: AIP65238
LinkDB All DBs
Position
2:1954141..1955829
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAHEWSGRAPLVIVPTKYYSTPTDAFRQAGISTV
IWANHLIRASASAMQAVAREIQESETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAALVLAASRGNGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKRQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIVSYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKVHLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLDTLKARDDFDSLDLPALLNALVDAGERIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGNGGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaatttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtggtggacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcttacgcggaagcgggtgccgacgcgatcctgattcacagcaagctgtcgcgg
cccgacgagatcctgcagttcgcgcacgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgcattccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcatccgcttccgcgatgcaggcggtcgcgcgcgaa
atccaggaaagcgaaacgctcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccggttgcaggacgccgacgaatactcggccgccgagcggatctacctgtcgtcgagc
tcgcgcgcgtcgaacgcggcgctcgtgctcgcggcgagccgcggcaacgggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaggcagggcgtgaacgacatcacggtcgtcggcggttatcgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcgcaaacc
ggcgagctcgcgtcgctcgcatgcgcggccgagcgtctcacgggcgacaccatcgtctcg
tacggcgatctgctgttccgcagctacatcctgcgcgacctcgccgagagcgaggccgag
ttcagcgtcgtcgtcgattcctcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaagtgcatttgcgccgc
gtgtcgagcgatgcgagcgaagccgcgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcgacacgctgaaggcgcgcgacgat
ttcgattcgctcgatctgccggccctcctgaacgcgctcgtcgacgcgggcgagcggatc
gaggtgcaatacgtgcacggccactggcgaggcgtcaacgatctcgacgatttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcaacgggggc
gcgcgatga

DBGET integrated database retrieval system