KEGG   Burkholderia thailandensis 2003015869: DR62_4383Help
Entry
DR62_4383         CDS       T03763                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
btha  Burkholderia thailandensis 2003015869
Brite
KEGG Orthology (KO) [BR:btha00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DR62_4383
Enzymes [BR:btha01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DR62_4383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Glutaredoxin DAO HI0933_like FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AIP65995
UniProt: A0A659JFW0
LinkDB All DBs
Position
2:1980783..1982390
Genome map
AA seq 535 aa AA seqDB search
MLDANLKTQLKSYLERITRPVELVASLDDGDKSRELRALLDEIASLSPQVFVVERRDEAE
RAPSFSVGEPGEAARIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDATIEQIRALDGDYT
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVDARRIMAVPTIFLNGET
FGQGRSSVREILAKLDSGASRRAAQALAAKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVTETEGPKFATALEQHVKQYEVDVIDVQRADRLVPGSLHE
IRLASGAVLKAKAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSEVTLIEYGAQLRADEVLQRKLRSLPNVMVLTHARTTELAGDGARL
NALVYEDMRTGETKRIALEGVFVQIGLVPNTEWLKGTVELSNHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSDADAVQPADADAPASAEMVAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctcaagactcagttgaaatcgtaccttgaacggatcacgcgtccc
gtcgagctcgtcgcatcgctcgacgacggcgacaagtcgcgcgagctgcgcgcgctgctc
gacgagatcgcgtcgctgtcgccgcaagttttcgtcgtcgagcgccgcgacgaggccgag
cgcgcgccgtcgttctcggtcggcgagccgggcgaagccgcgcgcatccgcttcgccggg
ataccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcaaacgggcggccat
ccggtgaagctcgacgacgcgacgatcgagcaaattcgcgcgctcgacggcgactacacg
ttcgagacgtatatctcgctcacctgtcagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggcgcgttgttccag
gacgaagtcgacgcgcgccggatcatggccgtgccgacgatcttcctgaatggcgagacg
ttcggccagggccgcagcagcgtgagggaaatcctcgcgaagctcgatagcggcgcgagc
cggcgcgcggcgcaggcgctcgcggcaaagcccgtgttcgacatgctgatcgtcggcggc
ggccccgccggcgccgccgccgcgatctacgcggcgcgcaagggcatctcgacaggcgtc
gtcgccgagcgcttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgacggaaaccgaagggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gaagtcgacgtgatcgacgtgcagcgcgccgaccggctcgtgccgggcagtctccatgaa
atccgtctcgcgagcggcgcggtgctgaaagcgaaggccgtcgtgctcgccacgggcgcg
cgctggcgggagatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacgggccgcttttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggcggcgatcgatctcgccggcatcgtcagtgaagtgacgctgatc
gaatacggcgcgcaactgcgcgcggacgaggtgctgcagcgcaagctgcgcagcctcccg
aacgtgatggtgctcacgcacgcgcgcacgactgagctcgcgggcgacggcgcgaggctc
aacgcgctcgtctacgaggacatgcgcacgggcgaaacaaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggaacggtcgagctg
tcgaatcacggcgagatcgtcgtcgacgcgcgcggcgcgacgtcggtgcccggggtgttc
gccgccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcgtcgctcggcgcgttcgactacctgatccgaagcgacgcggatgcggtgcag
ccggcggacgccgacgccccggcaagcgccgaaatggtggccgcctga

DBGET integrated database retrieval system