KEGG   Burkholderia thailandensis 2003015869: DR62_4637Help
Entry
DR62_4637         CDS       T03763                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00250  Alanine, aspartate and glutamate metabolism
btha00410  beta-Alanine metabolism
btha00640  Propanoate metabolism
btha00650  Butanoate metabolism
btha01100  Metabolic pathways
btha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DR62_4637
   00650 Butanoate metabolism
    DR62_4637
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DR62_4637
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DR62_4637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btha01007]
    DR62_4637
Enzymes [BR:btha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DR62_4637
Amino acid related enzymes [BR:btha01007]
 Aminotransferase (transaminase)
  Class III
   DR62_4637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIP65785
LinkDB All DBs
Position
2:2285771..2287054
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIAEQLEQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALRGVTSA
DSIAAVEALFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERAAVLGDKLKAKLAALRADVPQIADVRGPGAMVAAEFVD
PDTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIQDAVFDEALGILESVLK
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgacttctacgccgcgcgcgccgagaacgccgagctgtgggacgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtgaaggcgatcgccgagcagctcgagcagttcacgcacaccgcgtaccagatcgtg
ccgtacgcgtcgtatgtcgagctcgccgaaaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagcggtcgagaacgcggtgaagatc
gcgcgcgcttacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcaccggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtatccgaacgcgctgcgcggcgtgacgagcgcc
gactcgatcgccgccgtcgaagcgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtgcgcgcgctgcgcaagctgtgcgacgcgcacggcatcctcctcatcgccgacgaagtg
caaacgggcttcgcgcgcacgggcaagctgttcgcgatggagcactacgacgtctcggcc
gatctgatgacgatcgccaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggcggcctgggcggcacgtacgcgggcaat
ccgctcgcggtggccgccgcgcacgccgtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcggccgtgctcggcgacaagctgaaggcgaaactcgccgcgctgcgcgccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatggtagccgcggaattcgtcgat
ccggacacgcgcgcgtccgacgccgcgttcacgaagcgcgtgcagacgctcgcgctcgag
cgcggcctgctgctgctcatctgcggcgtcgacgcgaacgtgatacgtttcctgtttccg
ctcacgattcaggatgccgtgttcgacgaagcgctcggcattctcgaaagcgtgctgaag
gaggcggtgggcgtacccgcctga

DBGET integrated database retrieval system