KEGG   Burkholderia thailandensis 2003015869: DR62_5130Help
Entry
DR62_5130         CDS       T03763                                 

Definition
(GenBank) amylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00500  Starch and sucrose metabolism
btha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DR62_5130
Enzymes [BR:btha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DR62_5130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AIP65298
LinkDB All DBs
Position
2:complement(2870551..2873196)
Genome map
AA seq 881 aa AA seqDB search
MSAKHLGFKQAVLVGSLAALACAAFLPAHASAAEAFGSPGATAVRGPSAKSFLGTAVNGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAVQTDTRTMSW
QVTTSNGSHNWQIRKIIFADPNYNAIVQRVTFTALNGHKVGDFNLYLLSKPYLDNAGGGN
TAQTVSGSGGTALVANHNSRYSALVTSRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFSSATNGNVAQTGWIDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAGE
QQQYDTAWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDAN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTNCGIAEYNASGCAQGYS
RIGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTYT
SSGTFGNGSYYIRINPAGRSGTGTDRASFAPTAGPDTPQTLTVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIVNTISVYDSVLGQTLSLANAPALSPNAWFRYNFDGYGEHNDGSD
FDGTGAGRLWPIFTAERGMVEIARQGNGNAGSAYFSTLKQLTTPEGFLPEQVWSNSTTLP
DGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYSNCVAPP
QSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPANYPVWSNTVNLPAAQA
IQYKYYRKNADGSVTWENWSGNRQLQTPASGTLTLNDQVSW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaagcacttaggtttcaaacaggcggtgctggttggcagtctggccgcgctc
gcgtgcgcggcgttcttgcccgcgcatgcttcggctgccgaagcattcggctcgcccggc
gcaacggccgtgcgaggcccctcggccaagtcgttcctcggcacggcggtcaacggcgca
tcgcgggtctatttcaccggttatcggggcatcctgtccgaggtctactatccggttctc
gatacgccggagtccgtcgacctgcagttcctggtcggcgatgccggcaagaccttcgtc
gacgaagaaaagcagcaggcctactcggccgtgcaaacggacacgcgcacgatgagctgg
caagtgacgaccagcaacggttcgcataactggcaaatccgcaagatcatcttcgccgat
ccgaactacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccacaaggtc
ggcgatttcaatctttacctgctgtccaagccgtacctcgacaacgccggcggcggcaac
accgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcacgagccgcccgtggaaagtggtcaacggcgtcggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggacgttctcgtccgcgaccaacggcaacgtcgcgcagacgggctggatc
gatctcggcgacccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggaccaggcgctcggcgacgcgaacaccgtgctcggcagcgatctcgccggcgag
cagcagcagtacgacaccgcatggcacaactatgcggcgggcctgtcgtcgcagaacggc
gccgcggatgacggctactatctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcgaac
gcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggccggcgacacgtcgagcgcgacgagcgtcgtcaactatctgttcaacacgctgcag
cagacgacgaactgcggcatcgccgaatacaacgcgtccggctgcgcgcagggctacagc
cgcatcgggcgcttcccgcagaacgcgtgggtgaacggctggccgtactggcaaggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcggctcggcccgagcgtgttc
aatccgttgtggccgaagatcaagctcaccgccgactacatcgtcaacaccggcccgtgg
acgtatcaggagcgctgggaggaaaacgccggctactcgccgtcgacgatcgcggccgag
atcgcgggcctcgtcacggcggccgacatcgcgacgcaaaacggcgacacggcgagcgcc
gcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcacgttcggcaacggcagctactacatccggatcaatccggcgggccgctcg
ggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcagacg
ctgaccgtgaagaacggcggcggcagccacgatgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggcgtcaagcgcgcgaccgatccgacgatcgtcaacacgatc
tcggtctacgacagcgtgctcggccagacgctgagtctcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaatgacggcagcgac
ttcgacggcaccggcgcgggccgcctgtggccgatcttcaccgccgagcgcgggatggtc
gagatcgcgcgccagggcaacggcaacgcgggcagcgcgtacttctcgacgctcaagcaa
ctgacgacgcccgagggcttcctgccggaacaggtatggtcgaattcgacgacgctgccc
gacggctgggcggtgacgacgcccgccggctacacgccggggcagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgagtacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacagcaactgcgtcgcgccgccg
caaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacgggcaacgtcgccgcgctcggcaactggaacaccgatctcggcattccg
gtcgatccggccaactacccggtgtggagcaacaccgtcaacctgccggccgctcaggcg
atccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaactggtcc
ggcaaccgccagcttcagacgcccgcgagcggcacgctgacgctgaacgatcaggtgagc
tggtga

DBGET integrated database retrieval system