KEGG   Burkholderia thailandensis 2003015869: DR62_5277Help
Entry
DR62_5277         CDS       T03763                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00020  Citrate cycle (TCA cycle)
btha00190  Oxidative phosphorylation
btha00650  Butanoate metabolism
btha01100  Metabolic pathways
btha01110  Biosynthesis of secondary metabolites
btha01120  Microbial metabolism in diverse environments
btha01130  Biosynthesis of antibiotics
btha01200  Carbon metabolism
Module
btha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR62_5277 (sdhB)
   00650 Butanoate metabolism
    DR62_5277 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DR62_5277 (sdhB)
Enzymes [BR:btha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DR62_5277 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     DR62_5277 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_4 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AIP65241
UniProt: A0A2N8R2M8
LinkDB All DBs
Position
2:complement(88939..89646)
Genome map
AA seq 235 aa AA seqDB search
MSNTRTFEIFRYDPDRDAKPYMQAYEIEVPAGDRMLLDVLVRLKAQDETLSFRRSCREGV
CGSDAMNINRKNGLACITNLNDLPRHTVLRPLPGLPVVRDLIVDMTAFFKQYHSIKPYLI
NDTAPPERERRQSPEERDQLDGFYECILCACCSSACPSYWWNPDKYVGPAGLLQAYRFLV
DSRDEGTGERLDNLDDPYRLFRCRTILNCTDVCPKGLNPARAISEIRTMLARRTI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaacaccagaacctttgaaatattccgctacgatccggacagggacgccaaaccg
tacatgcaggcgtacgagatagaggtgcccgccggcgaccggatgttgctcgacgtactc
gtccgcctcaaggcacaggacgaaacgctgagctttcggcgttcgtgtcgcgaaggcgta
tgcggttcggatgcgatgaacatcaaccgcaagaacgggcttgcctgcatcaccaacctg
aacgacctcccccgccacacggtcctgcgtccgctgcccgggttgccagtcgttcgcgac
ctgatcgtggacatgaccgcgttcttcaagcagtaccactcgatcaagccctatctgatc
aacgacactgcgccgcccgaacgggaaaggcgccagtcgcccgaggagcgcgatcaactc
gacggtttctatgagtgtattttgtgcgcgtgctgttccagcgcgtgcccctcgtactgg
tggaatccggacaaatatgtcggccctgcaggcctgctgcaagcctatcgctttctggtc
gactcccgcgacgagggcacgggcgagcgacttgacaatcttgacgatccgtatcgcctc
ttccggtgtcggacgatactgaactgcaccgatgtctgtccgaaggggttgaacccggcc
agggcaatctccgagatccggaccatgcttgcgcgccggacgatctga

DBGET integrated database retrieval system