KEGG   Burkholderia thailandensis 2003015869: DR62_767Help
Entry
DR62_767          CDS       T03763                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00071  Fatty acid degradation
btha00280  Valine, leucine and isoleucine degradation
btha00281  Geraniol degradation
btha00310  Lysine degradation
btha00360  Phenylalanine metabolism
btha00362  Benzoate degradation
btha00380  Tryptophan metabolism
btha00410  beta-Alanine metabolism
btha00627  Aminobenzoate degradation
btha00640  Propanoate metabolism
btha00650  Butanoate metabolism
btha00903  Limonene and pinene degradation
btha00930  Caprolactam degradation
btha01100  Metabolic pathways
btha01110  Biosynthesis of secondary metabolites
btha01120  Microbial metabolism in diverse environments
btha01130  Biosynthesis of antibiotics
btha01212  Fatty acid metabolism
Module
btha_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:btha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DR62_767
   00650 Butanoate metabolism
    DR62_767
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DR62_767
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR62_767
   00310 Lysine degradation
    DR62_767
   00360 Phenylalanine metabolism
    DR62_767
   00380 Tryptophan metabolism
    DR62_767
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DR62_767
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DR62_767
   00281 Geraniol degradation
    DR62_767
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR62_767
   00627 Aminobenzoate degradation
    DR62_767
   00930 Caprolactam degradation
    DR62_767
Enzymes [BR:btha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DR62_767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AIP63401
UniProt: A0A2Z4SJR3
LinkDB All DBs
Position
1:complement(530968..531744)
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLITLNRPKALNALNDALMDELGAALKVFDADEGIGAIVLTGSEKA
FAAGADIGMMATYSYMDVFKGDYITRNWEAVRQVRKPVIAAVAGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVLPGAGGTQRLPRAVSKAKAMDMCLTARFMDAEEAERAGLVSRI
LPADKLLDEAIAAASTIAEFSLPAVMMVKEAVNRAYETTLSEGVHFERRLFHSAFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaaaacatcctggtggagacgcggggccgggtggggctgattacgctgaat
cgtccgaaggcgctgaatgcgctgaacgacgcgctgatggacgagctcggcgcggcgctc
aaggtatttgatgcggatgagggtatcggcgcgatcgtgctgacgggcagcgagaaggcg
ttcgcagctggcgccgacatcgggatgatggcgacctattcgtatatggacgtcttcaag
ggcgactacatcacgcgtaactgggaggcggtgcgtcaggttcgcaagccggtcattgcg
gcggtggcgggtttcgcgctgggcggcggctgcgagctcgcgatgatgtgcgacatcatc
tttgcggccgataccgcgaaattcggccaacccgaaatcaagctcggcgtgctgccgggg
gcgggcggcacgcagcgtctgccgcgagcggtatcgaaggcgaaggcaatggacatgtgc
ctaaccgctcgcttcatggatgcggaggaggccgagcgcgcggggctggtgtcgcggatt
ctgccggccgacaagttgctcgacgaagcgattgccgcggcgtcgacgatcgccgagttc
tcgttgcccgccgtgatgatggtgaaggaggcggtgaatcgcgcgtacgagacgaccttg
tccgaaggggtgcacttcgagcgccgcttgtttcattcggcgtttgcaactgaagatcag
aaggaaggcatggcggcgttcgtcgagaagcgcaagcccgtcttcaagcaccgctga

DBGET integrated database retrieval system