KEGG   Burkholderia thailandensis E254: BTN_1680Help
Entry
BTN_1680          CDS       T03380                                 

Gene name
dacB
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTN_1680 (dacB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bthe01002]
    BTN_1680 (dacB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bthe01011]
    BTN_1680 (dacB)
Enzymes [BR:bthe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTN_1680 (dacB)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BTN_1680 (dacB)
Peptidases and inhibitors [BR:bthe01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   BTN_1680 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:bthe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BTN_1680 (dacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AIT21029
LinkDB All DBs
Position
1:complement(1877379..1878743)
Genome map
AA seq 454 aa AA seqDB search
MSAARNVLPASVLVALQRARVPASSLSVVVERIGDSTPVVAWNASRPMQPASTMKLVTTY
AGLSLLGADYRWRTSAYADGGVDENGTLHGTLYVKGTGDPKLVPEELIDLVNKIRRAGIV
NVDGALVLDKTFFAPETRDLPPLDDDASAPYNVGPDPLLYAFKALSFTVTPTDNGAVAVD
VVPPLANLTVDNQLVEGQGSCGAARPTLVTDASGGLTASFAGDYPPSCGPTTTNLAVLNH
SAFFARGFLALWRQTGGSFSGTISEGKVPGRARPVASHHGPVLSSVVHDINKFSNNVMAR
NLFLTIGAVEHRPPATPAQSADTIRAFLAHSGLPTDGLTLENGSGLSRDERVSALSLADM
LQAANASPVAQAFVDSLPIAGVDGTMKNRLANAPVGGNAHIKTGTLRDVRAIAGYVASAD
GSSYVVVSFINDDRASAARAAHDALLEWVYEGPR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggccgcgcgcaacgtgctgcccgcgtcggtgctcgtcgcgctgcagcgcgcgcgc
gtgccggcgtcgagcctgagcgtcgtcgtcgagcggatcggcgactccacgcccgtcgtc
gcgtggaacgcgagccggccgatgcagcccgcatcgacgatgaagctcgtgacgacctac
gcggggctgtcgctgctcggcgccgactatcgctggcgcacgagcgcgtacgcggacggc
ggcgtcgacgagaacggcacgctgcacggcacgctgtacgtgaagggcacgggcgatccg
aagctcgtgcccgaggaactgatcgacctcgtcaacaagatccgccgcgcgggaatcgtc
aacgtcgacggcgcgctcgtgctcgacaagaccttcttcgcgcccgagacgcgcgacctg
ccgcccctcgacgacgacgcgagcgcgccttacaacgtcggccccgatccgcttctctac
gcgttcaaggcgctgtcgttcacggtgacgccgaccgacaacggcgcggtcgcggtcgac
gtcgtgccgccgctcgcgaacctgaccgtcgacaaccagttggtcgaaggccagggctcg
tgcggcgccgcgcgcccgacgctcgtgaccgacgcgagcggcgggctcaccgcgtcgttc
gcgggcgactatccgccgagctgcggcccgacgacgaccaacctcgcggtgctgaaccat
tccgcgttcttcgcgcgcggcttcctcgcgctgtggcgccagacgggcggctcgttctcg
ggcacgatctccgaaggcaaggtgccgggccgcgcgcggcccgttgcgtcgcaccacggc
ccggtgctgtcgagcgtcgtgcacgacatcaacaagttcagcaacaacgtgatggcgcgc
aacctgttcctcacgatcggcgcggtcgagcaccggccgcccgcgacacccgcgcagtcg
gcggacacgatccgcgcgttcctcgcgcacagcgggctgccgaccgacggcctcacgctc
gagaacggctcggggctctcgcgcgacgaacgcgtgagcgcgctgtcgctcgccgacatg
ctgcaggcggcgaacgcgagccccgtcgcgcaggcgttcgtcgattcgctgccgatcgcg
ggcgtcgacggcacgatgaagaaccggctcgcgaacgcccccgtcggcggcaacgcgcac
atcaagacgggcacgctgcgcgacgtgcgcgcgatcgcgggctacgtcgcgtcggcggac
gggtcgagctatgtcgtcgtcagcttcatcaacgacgaccgcgcatcggccgcgcgcgcg
gcgcacgacgcgctgctcgaatgggtgtacgaagggccgcgctga

DBGET integrated database retrieval system