KEGG   Burkholderia thailandensis E254: BTN_1767Help
Entry
BTN_1767          CDS       T03380                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00020  Citrate cycle (TCA cycle)
bthe00480  Glutathione metabolism
bthe01100  Metabolic pathways
bthe01110  Biosynthesis of secondary metabolites
bthe01120  Microbial metabolism in diverse environments
bthe01130  Biosynthesis of antibiotics
bthe01200  Carbon metabolism
bthe01210  2-Oxocarboxylic acid metabolism
bthe01230  Biosynthesis of amino acids
Module
bthe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bthe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTN_1767 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTN_1767 (icd)
Enzymes [BR:bthe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BTN_1767 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIT20955
LinkDB All DBs
Position
1:1977962..1979221
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPETSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GTFRDAGYALAQKEFGAVLIDGGPWMKFKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIIAAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENMQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcattccctacatcgagggcgacggcacgggc
ttcgatatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagatccactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggtccggacgtgtggctgccggaagagacgctgcaggtgctgaaggagtacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtctgcctgcgcccgattcagtacttcaagggcgttccc
tcgcccgtgcgcgagccggagaagaccaacatggtgatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccggaaacgtcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcacgttccgtgacgccggctatgcgctcgcccagaaggagttcggcgcggtgctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtgatcaag
gattcgatcgccgatgcgttcctgcagcagatcctgctgcgcccggccgagtacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgcttgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcaggcaaggactacgtgaacccgggttcggaaatcctg
tccgccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtcatcatcgcc
gcgatggaaaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatgcagtaa

DBGET integrated database retrieval system