KEGG   Burkholderia thailandensis E254: BTN_1881Help
Entry
BTN_1881          CDS       T03380                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00620  Pyruvate metabolism
bthe00680  Methane metabolism
bthe00710  Carbon fixation in photosynthetic organisms
bthe01100  Metabolic pathways
bthe01120  Microbial metabolism in diverse environments
bthe01200  Carbon metabolism
Module
bthe_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTN_1881
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BTN_1881
   00680 Methane metabolism
    BTN_1881
Enzymes [BR:bthe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BTN_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIT22199
LinkDB All DBs
Position
1:complement(2101574..2104558)
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPANAELPARRAAKTARKPNGAAARTIAPTNAASAKPHGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKTAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQAGTVAYALDKLRQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARERAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYTDIEEALAEHGLPA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGAVPVRSAGRGAAP
VRATPYADAEEFVADLRVLTDSLAVHHGESLATPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVIAELLARGGVEPDYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGAPHANARNGLMVIP
LFETIADLRNASDIMREFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFHERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEAAMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGGAVAAYLDGAPDAAERGKRVALLRKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTASALAEITGAQARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcctccgcc
ccggcgaacgccgagctccccgcccgccgcgccgcgaaaaccgcgcgcaagcccaacggc
gccgccgcgcgcacgatcgcgccgacgaatgccgcatccgcgaaaccgcacggccgcacg
cgcgaagacaaggatcgcccgctgttcgaggacatccgctatctgggccgcctgctcggc
gacgtcgttcgcgagcaggaaggcgacgccgtgttcgacgtcgtcgagacgatccgccag
accgccgtcaagttccgccgcgaggacgacaagaccgccgcgcagacgctcgagaagatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccaccacaaccgccgccgcagaatccacgcgctc
gcgggctccgcgccgcaggcgggcaccgtcgcgtacgcgctcgacaagctcaggcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgagggcgcgctgatcgtgcccgtg
ctgaccgcgcacccgaccgaagtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctcaccgcgcgcgagcgcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgg
ctcaccgtcgccgacgagatcgagaatgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacacggacatcgaggaggcgctcgccgagcacggcctgcccgcg
cgcgtgccggcgttcttccagatgggcagctggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcaatcgccaggcggcggtgatcttcgag
cattacctggaacaggtgcacaagctgggcgcggagctctccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctgaaggcgctcgcggccgcgtcgccggaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggcttgcggcaagcgcg
cgcgtgcggctcggcgaaggcgcggtgcccgtgaggagcgcgggccgcggcgccgcgccc
gtgcgcgccacgccgtatgcggacgccgaggaattcgtggccgacctgcgcgtgctgacc
gattcgctcgccgtgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgttcggctttcatctcgcgagcatcgacttgcggcaaagctcggac
atccatgaagcggtgatcgccgagctgctcgcgcgcggcggcgtcgagcccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaagagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcgcgcgcggtgcgcaactacatcatttcg
cataccgagacggtgagcgacctcgtcgaagtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcgcgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgaattcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctaccgcgcg
gaactggcgctcgtcgatctgttccacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggccgcggcggcggcccgacctatcaggcgatcctgtcgcagccg
cccggcacggtgaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaaccccgagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgccggcgttcgaggcggcgatg
cagacgctgtccgatgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
tttaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccgccccgcgtcgcgcaagctgcaggacccgaagcaccgcaagatcgaggatctgcgc
gcgattccgtggggtttctcgtggggccagtgccggctgctgctgacgggctggtacggc
ttcggcggcgcggtagccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctcaggaagatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcagtcgcgtcgcgctacgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcaccgc
acggcgagcgcgctcgccgagatcaccggcgcgcaagctcggctcgccgcgaatccgctc
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaggtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccac
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system