KEGG   Burkholderia thailandensis E254: BTN_2099Help
Entry
BTN_2099          CDS       T03380                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bthe00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BTN_2099
Enzymes [BR:bthe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BTN_2099
Transporters [BR:bthe02000]
 Other Transporters
  Pores ion channels [TC:1]
   BTN_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIT22352
LinkDB All DBs
Position
1:2334391..2335047
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLIEHGIPFDETLVNVPIKDPACFADTPLGKVPYLLTERGAL
SESQAIVEYLAASHPDKRIFPADPFDAAKAREIMTVLELYVEWNARELFPEAFFGGKVSD
GTKAHVEERMPRALDGFKRLARFSPYVLGDTFCIADIAAFVHFPITALATKAIYGRDFIA
DAGIDWKSYVKRIEEERPAAKRVSEERKAFIAGLAKQG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgtgtggttttcccgtgtccaattactacaacaaggtcaagttcgtcctg
atcgagcacggcattccgttcgacgagacgctcgtcaatgtcccgatcaaggatcccgcg
tgcttcgccgacacgccgctcggcaaggtgccgtatctgctgaccgagcgcggcgcgctc
agcgaatcgcaggcgatcgtcgaatatctcgccgcgagccacccggacaaacgcattttc
ccggccgacccgttcgacgccgcgaaggcgcgcgagatcatgacggtgctcgagctgtat
gtcgaatggaacgcgcgcgagctgtttccggaggcattcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgaggagcgcatgccgcgcgcgctcgacggcttcaagcggctt
gcgagattctcgccttacgtgctcggcgatacgttctgcatcgccgacatcgccgcgttc
gtccattttccgatcaccgcgctcgcgacgaaggcgatttatggccgcgatttcatcgcc
gacgccgggatcgactggaagtcatacgtgaagcgcatcgaggaggagcggccggccgcg
aagcgagtgagcgaggagcgcaaggcgttcatcgcggggctggcgaagcagggttga

DBGET integrated database retrieval system