KEGG   Burkholderia thailandensis E254: BTN_4315Help
Entry
BTN_4315          CDS       T03380                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00440  Phosphonate and phosphinate metabolism
bthe01100  Metabolic pathways
bthe01120  Microbial metabolism in diverse environments
bthe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTN_4315 (aepX)
Enzymes [BR:bthe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTN_4315 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Motif
Other DBs
NCBI-ProteinID: AIT22439
LinkDB All DBs
Position
2:1211588..1213276
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ADAYAEAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDAFRQAGISTV
IWANHLIRASASAMQAVAREIQESETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAALVLAASRGNGLEAVTGDKPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIVSYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKVHLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLKARDDFDSLDLPALLNALVDAGERIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGNGGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtggtggacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctggggaatggacgaggcgctgcgccgc
gcggacgcttacgcggaagcgggtgccgacgcgatcctgattcacagcaagctgtcgcgg
cccgacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgcattccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcatccgcttccgcgatgcaggcggtcgcgcgcgaa
atccaggaaagcgaaacgctcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcggatctacctgtcgtcgagc
tcgcgcgcgtcgaacgcggcgctcgtgctcgcggcgagccgcggcaacgggctcgaggcc
gtcaccggggacaagccgaaggtgatgctgccgatcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggttatcgc
gccgatgcgatcgacacgtccggcgtgaaactcgtcgtcaacgagcggcacgcgcaaacc
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctcacgggcgacaccatcgtctcg
tacggcgatctgctgttccgcagctacatcctgcgcgacctcgccgagagcgaggccgag
ttcagcgtcgtcgtcgattcctcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaagtgcatttgcgccgc
gtgtcgagcgatgcgagcgaagccgcgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggcacgctgaaggcgcgcgacgat
ttcgattcgctcgatctgccggccctcctgaacgcgctcgtcgacgcgggcgagcggatc
gaggtgcaatacgtgcacggccactggcgaggcgtcaacgatctcgacgatttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcaacgggggc
gcgcgatga

DBGET integrated database retrieval system