KEGG   Burkholderia thailandensis E254: BTN_4911
Entry
BTN_4911          CDS       T03380                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bthe  Burkholderia thailandensis E254
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bthe02044]
    BTN_4911
Secretion system [BR:bthe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTN_4911
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AIT23711
LinkDB
Position
2:1954897..1956246
AA seq 449 aa
MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKL
VFKSGTGIFSDGTPFDVPGHTPPPPPLTIASEHQDQVIYLAVPLRLPNTEETAFDEQAGS
LARYSAFEIELRDSNAIGQGPKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSV
ALHDGDHIPPVSQYGANPLLREWATQLHGLAKLRADALATRLSGSDGRAGAAAEVADYLL
LQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFVRPQTRRPRPTPGYDHAQLYA
SIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYSSLVLAVGAQMSPD
VLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGPFWE
QIAQQGGLAMHIAGHFPELKLELWGVRHK
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgagctggcataacaaggtggtgtggaacgaagggctgtttcttcttccccagttgttt
caacaacaggaacgttacttcgaatacttcgcgcacaagcgggccgctgtcctcagcccg
tttttctggggattcagccgatacgaaatcgatcaggagtcgctgtcgttcggcaagctc
gtcttcaagagcggcaccggaatattttccgacggcacgccgttcgatgtgccggggcac
acgccgccgccgccgccgctgacgattgcttcggagcaccaggatcaggtgatctatctc
gcggtgccgctgcgtctgccgaatacggaggaaaccgcgttcgacgaacaagcgggatcg
cttgcgcgctattcggcgttcgagatcgaattgcgcgacagcaatgcgatcggtcaaggg
cccaagccggtgcagctcgcgaacatgcggctgcgcctgctgcccgagaaggagctgacg
caatcctggatcggcattgcgctgacgcgcgtgaagacgcttcacgccgacggctcggtt
gcgctgcacgacggcgatcatatcccgccggtcagccaatacggggcgaatccgctgctg
cgcgaatgggccacccagttgcatggtctcgcgaagctgcgcgccgacgcgctcgcgaca
cgcctgtccggcagcgatggccgcgcaggcgcggcggccgaggtggcggattatctgttg
ctgcaggtgctgaaccggtatgagccgctgctcgagcacatctgcaggattcgcgaaatg
ccgcccgtgacgctctatcgcgagttgtcgatgctggcgggcgaattgtcgacgttcgtg
cgtccgcaaacgcgccggccccggccgacgcccggctacgatcacgcgcagttgtacgcg
agcattcgcccgctggtcgacgaggtgcattacctgttgaaccaggtgctgattcgaggc
gcccagccgattccgctcaccgagcagccgcacggcattcgcgtggccacgatgttgccg
tctgagctcgcgggttattcgagcctcgtgctcgcggtcggcgcgcaaatgtctccggac
gtgctgcagcagcagttcgcatcccaaacgaagatcagccatccgcagcggctgccggag
ctcattcgctctcacttgccgggcatgacgatgattccgttgccggtgcctccgcggcag
attccgttcaattccagttatatctattacgagctttcccgcacggggccgttctgggaa
cagatcgcacaacaaggcgggcttgcgatgcacatcgcgggtcacttccctgaactcaag
ctcgaactttggggagtgcgtcacaaatga

DBGET integrated database retrieval system