KEGG   Burkholderia thailandensis E254: BTN_733Help
Entry
BTN_733           CDS       T03380                                 

Definition
(GenBank) penicillin-binding , 1A family protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00550  Peptidoglycan biosynthesis
bthe01100  Metabolic pathways
bthe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTN_733
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BTN_733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bthe01003]
    BTN_733
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bthe01011]
    BTN_733
Enzymes [BR:bthe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BTN_733
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTN_733
Glycosyltransferases [BR:bthe01003]
 Polysaccharide
  Bacterial polysaccharide
   BTN_733
Peptidoglycan biosynthesis and degradation proteins [BR:bthe01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BTN_733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AIT20207
LinkDB All DBs
Position
1:807066..809402
Genome map
AA seq 778 aa AA seqDB search
MWLKLVLGVAGVCVALAVCVGLVLGYALVVASPNMPSLDALTDYRPKVPLRIYTADHVLI
GEFGEERRDIVRLQDVPDSLKKAVLAIEDARFYEHGGVDLTGIIRAGIVALTNGHATQGA
STITMQVARNFFLSSEKTYTRKIYEMLLAYRIERALTKDQILEVYMNQIYLGQRAYGFAA
AAHAYFNKDLKDITLAEAAMLAGLPKAPSAYNPVANPKRAKVRQQYILQRMLELNFITRE
QYDEALAEPLVVKSPSREYSVHAEYVAEMVRQMMYAQYKDEAYTRGLNVVTTIDSADQTL
AYRALRKGLMTYDRRHGYRGPEGFIELPASQDDREQAIDDALVDHPDNGELVAAVVTETG
PRQIRVVFSNGSDATVSGDDLRFAASSLSASAQPNKRIRPGAIVRVFKNDDGSWAIGQLP
QIEGAFISIVPQDGAIRSLIGGFDFNKNKFNHVTQAWRQPGSSFKPFIYSASLDKGLGPA
TIINDGPLYFSAAETGGQPWEPKNYGGGFEGPMSMRVALQRSRNLVSIRILNHIGPKYAQ
QYITRFGFDADRHPAYLPMALGAGLVTPLQMAGAFSVFANGGYRVNPYLIAEVTDPSGNV
VARAQPLVAEQNAPRAIDARNAYVMNSLLQSVAQRGTGARSNVLKRTDLAGKTGTTNDSR
DAWFGGYQHTLAAIAWIGYDNPRSLGDRETGGGLALPVWIDYMGPALKNVPEYKMPMPDG
VTTLGGELYFDQFTPGRGFVSTVGVNLPAAPPDSASAVPGHVDEQEKQDIMNLFRGGN
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgaagctcgtgctcggcgtcgcaggcgtgtgcgtggcgctcgcggtctgcgtc
gggctcgtgctcggctacgcgctcgtcgtcgcgtcgccgaacatgccgtcgctggacgcg
ctgaccgactaccgcccgaaggtgccgctgcgcatctacacggcggatcacgtgctgatc
ggcgaattcggcgaggagcgccgggacatcgtccgtctgcaggacgtgcccgattcgctg
aagaaagcggtgctcgcgatcgaggatgcgcgcttctacgaacacggcggcgtcgatctg
acgggcatcatccgcgccggcatcgtcgcgctgacgaacggccacgcgacgcagggcgcg
agcacgatcacgatgcaggtcgcgcgcaacttcttcctgtcgagcgagaagacatacacg
cgcaagatctacgagatgctgctcgcgtaccggatcgagcgtgcgctcacgaaagatcag
attctcgaggtctacatgaatcagatctatctgggccagcgcgcctatggcttcgccgcc
gccgcgcacgcgtacttcaacaaggacctgaaggacatcacgctcgccgaggccgcgatg
ctcgcggggctgccgaaggcgccgtccgcatacaacccggtcgcgaatccgaaacgcgcg
aaggtccgccagcaatacatcctgcagcggatgctcgagctgaacttcatcacgcgcgag
cagtacgacgaggcgctcgccgagccgcttgtcgtcaagagcccgagccgcgaatacagc
gtgcacgcggaatacgtcgccgaaatggttcggcagatgatgtatgcgcaatataaggac
gaggcgtacacgcgcgggctgaacgtcgtcacgacgatcgattccgcagaccagacgctc
gcgtaccgcgcgctgcgaaagggcctgatgacgtacgaccggcgccacggctatcgcggc
cccgaaggcttcatcgagctgcccgcgagccaggacgaccgcgagcaggcgatcgacgac
gcgctcgtcgaccatccggataacggcgagttggtcgcggccgtcgtcaccgaaaccggc
ccgcgacagattcgcgtcgtgttctcgaacggcagcgacgcgacggtgagcggcgacgat
ctgcgcttcgccgcaagctcgctgtcggcgagcgcgcagccgaacaagcggatccgcccc
ggcgcgatcgtgcgcgtgttcaagaacgacgacggctcgtgggcgatcgggcaactgccg
cagatcgagggcgcgttcatttcgatcgttccgcaggacggcgcgatccgctcactgatc
ggcgggttcgacttcaacaagaacaagttcaaccacgtgacgcaggcgtggcggcagccg
ggttcgtcgttcaagccgttcatttattcggcgtcgctcgacaaggggctcggccccgcg
acgatcatcaacgacggcccgctctatttcagcgccgccgagacgggcggccagccgtgg
gagccgaaaaactacggcggcggcttcgagggcccgatgtcgatgcgcgtcgcgctgcag
cgctcgcgcaacctggtatcgattcgcatcctgaatcacatcggcccgaaatacgcgcag
caatacatcacgcgcttcggcttcgacgcggatcgccacccggcctatctgccgatggcg
ctcggcgcgggcctcgtcacgccgctgcagatggcgggcgcgttctcggtgttcgccaac
ggcggctaccgggtcaatccgtatctgatcgccgaagtcaccgatccgagcggcaacgtc
gtcgcgcgcgcgcagccgctcgtcgccgagcagaacgcgccgcgcgcgatcgacgcgcgc
aacgcgtacgtgatgaacagcctgttgcaaagcgtcgcgcaacgcggcaccggcgcgcgc
tcgaacgtgctgaaacgcaccgacctggccggcaagaccggcacgacgaacgactcgcgc
gacgcatggttcggcggctatcagcacacgctcgcggcgatcgcgtggatcggctacgac
aacccgcgcagcctcggcgatcgcgaaaccggcggcggcctcgcgctgccggtgtggatc
gactacatgggccccgcgctcaagaatgtgccggaatacaaaatgccgatgcccgacggc
gtcacgacgctcggcggcgagttgtacttcgaccagttcacgccgggccgcggcttcgtc
tcgacagtcggcgtgaacctgccggccgcgccgcccgattccgcgagcgccgtgcccggg
catgtcgacgagcaggagaagcaggacatcatgaatctgttccgcggcggcaactga

DBGET integrated database retrieval system