KEGG   Burkholderia thailandensis E254: BTN_932Help
Entry
BTN_932           CDS       T03380                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00010  Glycolysis / Gluconeogenesis
bthe00620  Pyruvate metabolism
bthe01100  Metabolic pathways
bthe01110  Biosynthesis of secondary metabolites
bthe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTN_932 (acoD)
   00620 Pyruvate metabolism
    BTN_932 (acoD)
Enzymes [BR:bthe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BTN_932 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIT21189
LinkDB All DBs
Position
1:complement(1001978..1003498)
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPIGGEYFDNVSPVTGRPFTAIPRSREADVEL
ALDAAHAAKAGWAATDAAQRANVLLRIADRMEANLARLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAIKRVEAIKQGHPLDSQTMIGAQASSEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEAL
EIANDTQYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaatttccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccgatcggcggtgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgaagccgacgtcgagctc
gcgctcgacgccgcgcacgcggcaaaggcgggctgggccgcgacggacgcggcccagcgc
gcgaacgtgctgctgaggatcgccgatcggatggaggcgaacctcgcgcgcctcgcggtc
gccgagacgatcgacaacggcaagccgctgcgcgagacgaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gacatcggcggcgacatggtcgcctatcacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaactttccgctcctgatggccgcgtggaagctcgcgcccgcgctcgcg
gccggcaactgcgtcgtgctcaagcccgccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggc
ctcgaagcgggcaagccgctcgcgtcgagcaagcgaatcgcgaagatcgcgttcacggga
gagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctgattcccgtcacg
ctcgagctcggcggcaagagtccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgcacgtgcccgtcgcgcgcgctcgtcgaggagagcatctacgagcgcttcatcgagcgt
gcgatcaagcgcgtcgaggcgatcaagcaaggccatccgctcgattcgcagacgatgatc
ggcgcgcaggcgtcgtccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgagggcgcgcaatgcctgacgggcggcgagcgcaacgtgctcggcggcgaactcgcc
gaaggctactacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagagattttcgggccggtgctcgcggtgacgacgttcaagaccgaagaggaagcgctc
gagatcgcgaacgacacgcagtacggcctgggcgcgggcgtctggacgcgcgacggcaac
cgcgcgtaccgcttcggccgcggcatccaggccggccgcgtgtggaccaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcaatcgggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system