KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_01215Help
Entry
BTK_01215         CDS       T03473                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00473  D-Alanine metabolism
bthi00550  Peptidoglycan biosynthesis
bthi01100  Metabolic pathways
bthi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTK_01215 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTK_01215 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BTK_01215 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bthi01011]
    BTK_01215 (ddl)
Enzymes [BR:bthi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTK_01215 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bthi01011]
 Precursor biosynthesis
  Amino acid ligase
   BTK_01215 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AIE31375
LinkDB All DBs
Position
239221..240306
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEALKMSGAENAISPLSLSTEIIPSAASEENAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEKNREEAYSKVEDKLGYPC
FVKPANLGSSVGINKCKNREELEDAFVEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKRDAIIAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAIERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ctacagacggctcttgctgctattaaagcgttaaatcaagataaattcgagattcatcca
atttatattacagaacaaggtcaatgggtacgcggtgagcgtattgaaggcgaagtaaca
gatgttgaagctttaaaaatgagcggtgcagaaaatgcgatttctccgttatcattaagt
acagaaattatcccatctgcagcttctgaggagaacgctattgacgttattttcccatta
ctacatggaccaaacggtgaagatggaacggttcaaggactattagaattaatgaatatc
ccttatgtaggaaatggtgttctagcatcatctgctggtatggataaagttgttatgaaa
aacatctttgcagaggctggtttaaaacaagcaaaatatgcatccttcattcgtagtgca
tgggagaaaaatcgtgaggaagcttattctaaagtagaagataagttaggatatccttgc
ttcgtaaaaccagcgaaccttggttcaagtgttggtattaataagtgtaaaaatcgtgaa
gaacttgaggatgcatttgtagaggcattccaatttgatcgcaaaattattgtagaagaa
aatattgtaggtcgtgaagtagaagttggggtactaggtaatgatgagccgaaatgttca
gttgtaggtgaaatcgttccgaaaaaggacttctatgattataagtcgaaatatatcgat
ggtgatacggcgctaattattccagctgaaatgacagaagaagaatctaatgtaattaag
cgtgatgcgattattgcattccaatcattagacggtgcaggtttaacgcgagctgatttc
ttcttaacgaaagatggagaagtgtatattaacgaagtaaacacaatgccaggatttaca
ccgttcagtatgttccctctattatggcaacatactgggttaccgtatccagaattaatt
gaagagctaattcgtttagcgattgaacgtcacgaagaaaaacaaaaaattaaatataca
atctaa

DBGET integrated database retrieval system