KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_06515Help
Entry
BTK_06515         CDS       T03473                                 

Definition
(GenBank) competence transcription factor
  KO
K02250  competence protein ComK
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BTK_06515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bthi03000]
    BTK_06515
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bthi02044]
    BTK_06515
Transcription factors [BR:bthi03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BTK_06515
Secretion system [BR:bthi02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BTK_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: AIE32410
LinkDB All DBs
Position
1278715..1279296
Genome map
AA seq 193 aa AA seqDB search
MESKVERYVENYVVTKNTMALLPVILSEKKIVTRVVEMNDSFFVFQKPLDIIERSCRKHG
SSFLGRKEGTKELTHITHKAPIAISPADQLYFFPTYSYSRKECAWLSHFYIESNKELEDG
NLIIRFINGFAVKLEISKTSFENQQNRTAKLRTEYEDRRKKQGNPCFKEVDKKEESTLRP
AYEKVYFVKEGEV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtggaacgctatgtcgaaaattatgttgtaacgaaaaatacgatggcc
ttacttcctgttattctaagtgaaaagaaaattgttacgcgagtcgttgaaatgaatgat
tcttttttcgtatttcaaaaacctctagatattatagaaagaagttgccgcaagcatggc
tctagtttcttaggcagaaaagaaggaacgaaagagttaactcatattacacataaagca
ccgattgcgattagtccagcagatcaactttattttttccctacctattcttactctaga
aaagagtgcgcttggttgtctcatttttatattgaaagtaataaagaattagaagatgga
aatcttattattagatttataaatggctttgctgtgaaattagaaatatcaaaaactagt
tttgaaaatcaacaaaatcgtacagcgaaattacgtactgaatatgaagatcgtaggaaa
aaacaagggaatccttgttttaaagaggtcgataaaaaagaggaatcaacattaagaccc
gcttatgagaaggtgtattttgtgaaggaaggcgaagtgtga

DBGET integrated database retrieval system