KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_08345Help
Entry
BTK_08345         CDS       T03473                                 

Definition
(GenBank) imidazole glycerol phosphate synthase subunit HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00340  Histidine metabolism
bthi01100  Metabolic pathways
bthi01110  Biosynthesis of secondary metabolites
bthi01230  Biosynthesis of amino acids
Module
bthi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BTK_08345
Enzymes [BR:bthi01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     BTK_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus NMO TMP-TENI DHO_dh G3P_antiterm ThiG PEP_mutase IMPDH
Motif
Other DBs
NCBI-ProteinID: AIE32764
LinkDB All DBs
Position
1592411..1593169
Genome map
AA seq 252 aa AA seqDB search
MLAKRIIPCLDVKEGRVVKGVNFIGLQDVGNPVEIAEAYNEAGADEIVFLDITATHEGRK
TIIDVVEKTAAKVFIPLTVGGGISSVKDMYNLLRAGADKVSINSAAVRNPKLIEEGAEHF
GSQCIVVAIDARKVAEGKWNVYVNGGRVDTGMDAIEWAKRVVKLGAGEILLTSMDADGTK
SGYDLRLTEEISKSVSIPVIASGGCGHTDHIIEVFQKTTVDAALAASIFHYGEATVQSVK
RKLRDANVEVRL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgaaacgaatcattccatgtctagatgtgaaagaagggcgagtcgtaaagggt
gtaaattttataggattacaagatgtcggtaatccggttgaaatagctgaagcatataac
gaggcaggggcagatgaaatcgtatttttagatattacagcgactcatgaaggaagaaaa
acgattatagatgttgtagaaaaaacagcagctaaagtatttattcctcttacggttggc
ggggggatttcaagtgtgaaagatatgtacaatttactaagagctggagcagacaaagtt
tcaataaactcagcggcagtgcgaaacccgaagcttatagaagaaggggcagaacacttt
ggatcacaatgtattgtcgtggcaattgatgctagaaaagtagcagaaggtaaatggaac
gtatacgtcaacggcggaagagttgacacaggaatggatgccatagaatgggcgaagcgt
gttgttaaacttggggcaggtgaaattttgttaacgagtatggatgcagatggaacgaaa
agcggatatgaccttcgtttaacagaagaaatttcaaaaagtgtttccattccagtcatc
gcatcagggggctgtggtcatacggatcacattatagaagtttttcaaaagacaacagtt
gatgcagcgttagcggcatccatctttcattatggtgaggcgacagtgcagagtgtaaag
cgaaaattaagagatgcaaatgttgaggtgcggttatga

DBGET integrated database retrieval system