KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_08355Help
Entry
BTK_08355         CDS       T03473                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00340  Histidine metabolism
bthi01100  Metabolic pathways
bthi01110  Biosynthesis of secondary metabolites
bthi01230  Biosynthesis of amino acids
Module
bthi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BTK_08355 (hisE)
Enzymes [BR:bthi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BTK_08355 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG MazG-like
Motif
Other DBs
NCBI-ProteinID: AIE32766
LinkDB All DBs
Position
1593482..1593805
Genome map
AA seq 107 aa AA seqDB search
MENAFKLLYKTIEERKESPLPESYTNYLFSKGEDKILKKIGEECAEVIIACKNNDKEEVV
KEMVDVFYHCFVLLAEKNITLEDVMREVKERNGKLSRVGDRREIDTL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgcctttaagttgctgtataaaacaattgaagaacgaaaggaaagcccactt
cctgaatcgtatacaaattatttattttcaaaaggagaagataaaattttaaagaaaatt
ggtgaagagtgtgctgaagtaattatcgcatgtaaaaataatgataaagaagaagtagtg
aaagaaatggttgatgtattttatcactgtttcgttttattagctgaaaaaaatattaca
ttggaagatgtcatgcgagaggtgaaagaacgaaatggaaagctttcgagagttggggat
agaagggaaatagatacattataa

DBGET integrated database retrieval system