KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_11430Help
Entry
BTK_11430         CDS       T03473                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00473  D-Alanine metabolism
bthi01100  Metabolic pathways
bthi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTK_11430
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BTK_11430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bthi01011]
    BTK_11430
Enzymes [BR:bthi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BTK_11430
Peptidoglycan biosynthesis and degradation proteins [BR:bthi01011]
 Precursor biosynthesis
  Racemase
   BTK_11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIE33373
LinkDB All DBs
Position
2179842..2181017
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKANGYGHGAVEVAKAAIEAG
IHQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMVRVGIGVYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaaagaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagcggga
atacatcaacttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaatt
actgtaccaattttaattttaggatacacaccagtagcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgta
gaggtagtagggatgtttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgttaatacagcgaaagaattaggaattcaa
ataccatatattcatagttcaaatagtgcgggatcaatggaattaagtaacacatttcaa
aatatggtacgcgttggaataggagtgtacggtatgtatccatcaaaagaagtggatcat
tcagtcgtttctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacat
gcgaagaagaatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
attgcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaatggggttcgagtacctgttattggccgtgtttgtatggatcagtta
atgttggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcgcagtagaagaaatagcggatatgttaggtacaataaac
tatgaagttacatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system