KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_16750Help
Entry
BTK_16750         CDS       T03473                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Pathway
bthi00473  D-Alanine metabolism
bthi00550  Peptidoglycan biosynthesis
bthi01100  Metabolic pathways
bthi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTK_16750 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTK_16750 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BTK_16750 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bthi01011]
    BTK_16750 (ddl)
Enzymes [BR:bthi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTK_16750 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bthi01011]
 Precursor biosynthesis
  Amino acid ligase
   BTK_16750 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 GARS_A RimK CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIE34406
LinkDB All DBs
Position
complement(3247607..3248521)
Genome map
AA seq 304 aa AA seqDB search
MKIGVIMGGVSSEKQVSIMTGNEMIAHLDKNKYEIVPITLNEKVDLIEKAKDIDFALLAL
HGKYGEDGTVQGTLESLGIPYSGSNMLSSSICMDKNISKKILRYEGVETPDWIELTKMED
LNLDELDKLGFPLVVKPNSGGSSVGVKIVYNKNELISMLETVFEWDSEVVIEKYIKGDEI
TCSILDGKQLPIVSIRHAAEFFDYNAKYDDTSTVEEVIELPVEINERVNKASLACYKALK
CSVYARVDMMVKDGIPYVMEINTLPGMTQSSLLPKSAEAAGISYSELLDMIIETSLKVRK
EEGF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtgttattatgggcggggtatcgtctgaaaaacaagtttcaattatgacg
gggaatgaaatgattgctcatttagataaaaataagtatgaaatagttccaattacatta
aatgaaaaagtggatttaattgaaaaagcgaaagacattgactttgcgttgctcgcgtta
cacggaaaatacggagaagatgggacagttcaaggaacactggagagtttagggattcct
tatagcggaagtaatatgttatctagcagtatatgtatggataaaaatatttcgaaaaag
attttacgttatgaaggtgtagaaacaccagattggattgaacttacaaaaatggaggat
ctaaatcttgatgagttagataagttaggatttccattagtagtaaaaccaaactctggc
ggatcgagtgtcggagtgaaaatcgtttataataaaaatgaattgatctcaatgctagaa
actgtattcgaatgggattctgaagtagtaattgagaagtatataaaaggtgatgaaatt
acatgttcaattctggatggaaaacagttacctatagtttcaattcgacatgcagccgag
ttctttgactacaatgcaaaatatgatgatactagtacagttgaggaagtcatcgaactt
ccagtagaaattaatgaacgtgtaaataaagcgtcacttgcttgttataaagcattaaaa
tgtagtgtttatgcaagagttgatatgatggtgaaggacggaattccatatgtaatggaa
attaatacattaccagggatgacacaatcaagtttattgccaaaaagtgcagaagcggcg
ggaattagttatagcgaactattagatatgattattgaaacatcattaaaagttagaaaa
gaagaagggttttaa

DBGET integrated database retrieval system