KEGG   Bacillus thuringiensis serovar kurstaki HD-1: BTK_28775Help
Entry
BTK_28775         CDS       T03473                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K06595  heam-based aerotactic trancducer
Organism
bthi  Bacillus thuringiensis serovar kurstaki HD-1
Brite
KEGG Orthology (KO) [BR:bthi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bthi02035]
    BTK_28775
Bacterial motility proteins [BR:bthi02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BTK_28775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Protoglobin MCPsignal DUF948 FlaF DUF3037 T2SSF Frigida
Motif
Other DBs
NCBI-ProteinID: AIE36746
LinkDB All DBs
Position
5552409..5553710
Genome map
AA seq 433 aa AA seqDB search
MLGVFKKNINKTNASIIELSKDQQITFNVPTNSELKIQMDMLHISKEDLQVVKVLQPFIY
AEIDWITEKFYANITKQPNLITIIERYSSIPKLKQTLKTHIKELFSGNMHEDFIEQRVRI
AKRHVQIGLHRKWYTAAYQELFRSIMKILQTKITTIDDFSYSINVINKLFTLEQELVLAA
YESEYERMQKEHEKEKELTAMTITHIATELAAVSEKTSSSIQKLTAKSETIVEIAKTGTS
LATTSEEKANKGKEQLNQQNKRMGSIQMNMETIITDTHELLNISNKINEIIDIVKSIAEQ
TNLLALNAAIESARAGEFGKGFSVVAGEIRKLSEQTKESIFNVTKLVEKTNEQITRVSSS
VKQISSLVSEGTDSMSATDRYFQEIVKDMSNSKEQNKKIEHELQAISQVMKGIQDDSSQM
ALTADNLQLELNR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcttggggttttcaaaaaaaatattaataaaacaaatgccagtataatcgaattaagt
aaggaccaacaaataacttttaatgtccctactaattctgaattaaaaattcaaatggat
atgctacatatttcaaaagaagatttacaagttgtaaaagtactacagccttttatttat
gcagaaattgattggattactgaaaaattctatgccaacattacaaaacaacctaattta
attactattattgaacgttacagctctattccaaaactaaaacaaactttaaaaacacat
attaaagaattattcagcggcaatatgcatgaagattttattgaacagcgtgttaggatt
gccaaaaggcatgtacaaattggtttacatcgaaaatggtatactgctgcttatcaagaa
ttgttccgctctatcatgaagattttgcaaacaaaaataacaacaatcgatgatttttcc
tattctataaatgttataaataaattatttactcttgaacaagaacttgttcttgcagct
tatgaatctgaatatgaaagaatgcaaaaagagcatgagaaagaaaaagaactaactgct
atgacaattacgcatatcgcaacagaactagctgctgtatctgaaaaaacaagctcttct
attcaaaaactaaccgccaaatctgaaactattgtagagattgctaaaacaggtacatca
ttagctacaacatctgaagaaaaagccaataaagggaaagaacaattaaaccagcaaaac
aaacgaatgggatctattcaaatgaatatggaaacgattattacagatactcatgaactc
cttaatatttctaacaaaattaatgaaatcatagatattgttaaatcgattgcggagcaa
accaatttactcgcactaaatgcagctatcgagtctgcacgtgctggagaatttgggaag
gggttttctgttgttgctggtgaaattcgaaaattatcagagcaaacgaaagaatctata
tttaacgttacaaagctcgttgaaaaaacaaatgaacaaattacccgtgtctcgtcttcc
gtgaaacaaattagctctctcgtatcggaaggaacggatagtatgtcagcaacagatcga
tacttccaagaaattgtaaaagatatgtctaactcaaaagaacagaataagaaaattgaa
cacgagctacaagctatttcacaagtaatgaaaggaattcaagatgattcctcacaaatg
gctctaacagccgataatttacaactagaactaaatcgataa

DBGET integrated database retrieval system