KEGG   Burkholderia thailandensis 2002721643: BG87_1312Help
Entry
BG87_1312         CDS       T03882                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
bthl  Burkholderia thailandensis 2002721643
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BG87_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AJX98283
LinkDB All DBs
Position
I:complement(1461588..1462382)
Genome map
AA seq 264 aa AA seqDB search
MSLPHIDLLYSLSGVFVGFLVGLTGVGGGSLMTPILVLLFNVHPATAVGTDLLYAAITKA
TGTFVHGLKGTVEWRITGRLAAGSVPAAAITLWLLHSHGMHSQATSRMIQLVLGAALLLT
SLSLLFRPQLAAFAAKRTRALPPSPARTLAATVLTGAVLGVLVSLTSVGAGAIGVTVLLL
LYPALSTTRIVGSDIAHAVPLTLVAGVGHWMLGSVDWAILVSLLIGSVPGIVVGSHLSTR
APEGLLRRILATTLVAVGAKLVLS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgccccatatcgatctgctgtactccctgtccggcgtcttcgtcggttttctc
gtcggcttgacgggcgtcggcggcggatcgctgatgacgccgatcctcgtgctgctgttc
aacgtccacccggcgacggcggtcggcaccgacttgctctacgcggcgatcacgaaggcg
acgggcaccttcgtgcatgggctcaagggcaccgtcgaatggcggatcaccgggcgcctc
gcggcgggcagcgtgcccgccgccgcgatcacgctgtggctcctgcattcgcacggcatg
cactcgcaggcgaccagccggatgattcagctcgtgctcggcgccgcgctgctgctcacg
tcgctgtcgctgctgttccgcccgcaactcgccgcgttcgccgcgaagcgcacgcgcgcg
ctgccgcccagcccggcgcgcacgctcgccgcgaccgtgctcacgggcgccgtgctcggc
gtgctcgtgtcgctgacctcggtcggcgcgggcgcgatcggcgtgacggtcctgctgctg
ctctacccggccctgtcgacgactcgcatcgtcggctccgacatcgcgcacgcggtcccg
ctcacgctcgtcgcgggcgtcgggcactggatgctcggctcggtcgactgggcgatcctg
gtgtcgctgctgatcgggtcggtgcccggtatcgtcgtcggcagccatctgtcgacgcgc
gcgcccgaagggctgttgcgccggattctcgcgacgacgctcgtcgcggtcggcgcgaag
ctcgtgctgtcctga

DBGET integrated database retrieval system