KEGG   Burkholderia thailandensis 2002721643: BG87_2332Help
Entry
BG87_2332         CDS       T03882                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bthl  Burkholderia thailandensis 2002721643
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BG87_2332
Enzymes [BR:bthl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BG87_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AJX98277
LinkDB All DBs
Position
I:complement(2636271..2637362)
Genome map
AA seq 363 aa AA seqDB search
MTNRNDDTQQMTAIVCHAPEDYRVERVAKPRANARELVIRIGACGICASDCKCHSGAKMF
WGGPSPWVKAPVIPGHEFFGHVEELGEGAAEHFGVALGDRVIAEQIVPCGNCRYCKSGQY
WMCEVHNIFGFQREVADGGMAEYMRIPSTAIVHRIPLGISLEDAAIIEPLACAIHTVNRG
DIQLDDVVVIAGAGPLGLMMTQVAKLKTPKRLVVIDPVGERLALAREYGADVTIDPTRED
ALAIVHELTGGYGCDVYIETTGVPAGVTQGMSLIRKLGRFVEFSVFGKDTALDWSIIGDR
KELDVRGAHLGPYCYPVAIDLLARGLVTSKGIVTHGFSLEEWDEAIRVANSLGSIKVLMK
PRG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgaaacgacgacacgcagcagatgacggcgatcgtctgccacgcccccgag
gactatcgcgtcgagcgcgtcgcgaagccgcgcgcgaacgcgcgcgagctcgtgatccgc
atcggcgcgtgcggaatctgcgcgagcgactgcaagtgccattccggcgcgaagatgttc
tggggcggcccgagcccgtgggtcaaggcgcccgtgattcccggccacgagttcttcggc
catgtcgaggaactgggcgagggcgcggccgagcacttcggcgtcgcgctcggcgatcgc
gtgatcgccgagcagatcgtgccgtgcggcaattgccgctactgcaagtcgggccagtac
tggatgtgcgaggtccacaacatcttcggcttccagcgagaagtcgccgacggcgggatg
gccgagtacatgcggattccgtccaccgcgatcgtccaccggattccgctcggcatctcg
ctcgaggacgcggcgatcatcgagccgctcgcgtgcgcgatccacacggtcaatcgcggc
gacatccagctcgacgacgtcgtcgtgatcgcgggcgcggggccgctcggcctgatgatg
acgcaggtcgcgaagctgaagacgccgaagcggctcgtcgtgatcgatcccgtcggcgaa
cggctcgcgctcgcgcgcgaatacggcgcggacgtgacgatcgacccgacgcgcgaggac
gcgctcgcgatcgtgcacgagctgacgggcggctacggctgcgacgtctacatcgagacg
accggcgtgccggcgggcgtcacgcaggggatgagcctgatccgcaagctcggccgcttc
gtcgagttctcggtgttcggcaaggacacggcgctcgactggtcgatcatcggcgatcgc
aaggagctcgacgtgcgcggcgcgcatctcggcccgtattgctatcctgtcgcgatcgat
ctgctcgcgcgcgggctcgtcacgtcgaagggcatcgtcacgcacggcttctcgctcgaa
gaatgggacgaggcgatccgggtcgcgaactcgctcggctcgatcaaggtgctgatgaag
ccgcgcggctga

DBGET integrated database retrieval system