KEGG   Burkholderia thailandensis 2002721643: BG87_2805Help
Entry
BG87_2805         CDS       T03882                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bthl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BG87_2805
Enzymes [BR:bthl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BG87_2805
Transporters [BR:bthl02000]
 Other Transporters
  Pores ion channels [TC:1]
   BG87_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJX98838
LinkDB All DBs
Position
I:complement(3196295..3196951)
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLIEHGIPFDETLVNVPIKDPACFADTPLGKVPYLLTERGAL
SESQAIVEYLAASHPDKRIFPADPFDAAKAREIMTVLELYVEWNARELFPEAFFGGKVSD
GTKAHVEERMPRALDGFKRLARFSPYVLGDTFCIADIAAFVHFPITALATKAIYGRDFIA
DAGIDWKSYVKRIEEERPAAKRVSEERKAFIAGLAKQG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgtgtggttttcccgtgtccaattactacaacaaggtcaagttcgtcctg
atcgagcacggcattccgttcgacgagacgctcgtcaatgtcccgatcaaggatcccgcg
tgcttcgccgacacgccgctcggcaaggtgccgtatctgctgaccgagcgcggcgcgctc
agcgaatcgcaggcgatcgtcgaatatctcgccgcgagccacccggacaaacgcattttc
ccggccgacccgttcgacgccgcgaaggcgcgcgagatcatgacggtgctcgagctgtat
gtcgaatggaacgcgcgcgagctgtttccggaggcattcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgaggagcgcatgccgcgcgcgctcgacggcttcaagcggctt
gcgagattctcgccttacgtgctcggcgatacgttctgcatcgccgacatcgccgcgttc
gtccattttccgatcaccgcgctcgcgacgaaggcgatttatggccgcgatttcatcgcc
gacgccgggatcgactggaagtcatacgtgaagcgcatcgaggaggagcggccggccgcg
aagcgagtgagcgaggagcgcaaggcgttcatcgcggggctggcgaagcagggttga

DBGET integrated database retrieval system