KEGG   Burkholderia thailandensis 2002721643: BG87_3136Help
Entry
BG87_3136         CDS       T03882                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl01100  Metabolic pathways
bthl01110  Biosynthesis of secondary metabolites
bthl01120  Microbial metabolism in diverse environments
bthl01130  Biosynthesis of antibiotics
bthl01200  Carbon metabolism
bthl01210  2-Oxocarboxylic acid metabolism
bthl01230  Biosynthesis of amino acids
Module
bthl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bthl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BG87_3136 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG87_3136 (icd)
Enzymes [BR:bthl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BG87_3136 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AJX98289
LinkDB All DBs
Position
I:complement(3550710..3551969)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPETSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GTFRDAGYALAQKEFGAVLIDGGPWMKFKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIIAAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENMQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcattccctacatcgagggcgacggcacgggc
ttcgatatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagatccactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggtccggacgtgtggctgccggaagagacgctgcaggtgctgaaggagtacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtctgcctgcgcccgattcagtacttcaagggcgttccc
tcgcccgtgcgcgagccggagaagaccaacatggtgatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccggaaacgtcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcacgttccgtgacgccggctatgcgctcgcccagaaggagttcggcgcggtgctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtgatcaag
gattcgatcgccgatgcgttcctgcagcagatcctgctgcgcccggccgagtacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgcttgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcaggcaaggactacgtgaacccgggttcggaaatcctg
tccgccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtcatcatcgcc
gcgatggaaaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatgcagtaa

DBGET integrated database retrieval system