KEGG   Burkholderia thailandensis 2002721643: BG87_331Help
Entry
BG87_331          CDS       T03882                                 

Definition
(GenBank) amino acid permease family protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bthl  Burkholderia thailandensis 2002721643
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BG87_331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: AJX99535
LinkDB All DBs
Position
I:374329..375732
Genome map
AA seq 467 aa AA seqDB search
MSLFRKKNVDRMIAGAHAAGLKKALGAVDLTFLGIGAIIGTGIFVLTGTGAVQAGPALML
SFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWIIGWDLMLEYGLAASAV
SVGWSGYLQSLLQGFGVSLPAALTAAPGALPGVVTYFNLPAFLVMLVITTLLSIGIREST
RVNNIMVFIKVAVVLLVIAVGIFHVTPANWKPFMPHGWNGVFGAAAVMFFAFIGFDAVSS
AAEEVKNPKRDLPVGIIASLGVCAFLYVAVAAIATGIVPWAQYANVSHPISYALQVAGEK
WVAGFIDLGAVIGMLTVILVMSYGQTRIIFAMSRDGLLPAALSRVHPRFATPFLTTWLVG
LFFGLIAALIPLNVLAELINIGTLAAFSMVSIAVLVLRRTHPDLPRAFRCPGVPFVPILA
VAACLFLMLNLQPVTWIAFLTWLVIGLFVYFAYSRSRSKLAHGAQQH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttttccgcaagaaaaacgtcgaccgcatgatcgccggcgcgcacgcggccggc
ctcaagaaggcgctcggcgcggtcgacctcacctttctcggcatcggcgcgatcatcggc
accggcatcttcgtgctgaccggcacgggcgccgtgcaagccggccccgccttgatgctg
tcgttcgtgatcgcggcgatcgcatgcggcctcgccgcgctgtcgtacgccgaattcgcg
tcgacgatccccgtcgccggctcgatctacacgtattcgtacgcgaccctcggcgagctc
gtcgcgtggatcatcggctgggacctgatgctcgagtacgggctcgcggcgtccgcggtg
tcggtcggctggtccggctacctgcaatcgctgctgcagggcttcggcgtgtcgctgccg
gccgcgctcaccgccgcgccgggcgcgctgccgggcgtcgtcacctatttcaacctgccg
gcgtttctcgtgatgctcgtcatcacgacgctgctgtcgatcggcatccgcgaatcgacg
cgcgtgaacaacatcatggtgttcatcaaggtcgccgtcgtgctgctcgtgatcgcggtc
ggcatcttccacgtgacgcccgcgaactggaagccgttcatgccgcatggctggaacggc
gtgttcggcgcggcggccgtgatgttcttcgcgttcatcggcttcgacgcggtgtcgtcg
gccgccgaggaagtgaagaatccgaagcgcgatctgccggtcggcatcatcgcgtcgctc
ggcgtgtgcgcgttcctgtacgtcgcggtcgcggccatcgcgacgggcatcgtgccgtgg
gcgcagtacgcgaacgtctcgcacccgatctcgtacgcgctgcaggtcgcgggcgagaag
tgggtggcgggcttcatcgatctcggcgccgtcatcggcatgctgaccgtgatcctcgtg
atgagctacggccagacccggatcatcttcgcgatgtcgcgcgacggcctgctgcccgcc
gcgctgtcgcgcgtgcacccgcgcttcgcgacgccgttcctgacgacctggctcgtcggc
ctgttcttcggcctgatcgccgcgctgattccgctgaacgtgctcgccgagctgatcaac
atcggcacgctcgccgcgttctcgatggtgtcgatcgcggtgctcgtgctgcgccgcacg
cacccggacctgccgcgcgcgttccgctgcccgggcgtgccgttcgtgccgatcctcgcg
gtcgccgcgtgcctgttcctgatgctgaacctgcagcccgtcacgtggatcgcgttcctg
acgtggctcgtgatcggcctcttcgtgtacttcgcctactcgcgcagccgctcgaagctt
gcgcacggcgcgcagcagcattga

DBGET integrated database retrieval system