KEGG   Burkholderia thailandensis 2002721643: BG87_3916Help
Entry
BG87_3916         CDS       T03882                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00040  Pentose and glucuronate interconversions
bthl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BG87_3916
Enzymes [BR:bthl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BG87_3916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AJY02389
LinkDB All DBs
Position
II:complement(671811..672845)
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARDLALRDIDLPLEVGPADVKIRIHTVGVCGSDVHYYTHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTHLRAGDRVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPQNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFASNRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNAKAYAGIVDLLCPNGCLVLVGMPLEPVPLDVVALQAKEARIESVFRYANVFPRALA
LIESGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgatctcgcgctgcgcgacatcgacctgccg
ctcgaggtcggccccgccgacgtcaagatccgcatccacacggtgggcgtctgcggcagc
gacgtccactattacacgcacggcgggatcggcccgttccgggtcgacgcgccgatggtg
ctcggccacgaggcgtccggcacggtcgtcgaggtcgggcgcgacgtcacgcacctgcgc
gcgggcgaccgcgtctgcatggaacccggcgtcccgcgcttcgattcgaaggcgacactg
cacggcctctacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcatccggcggcgttcacgtaccggctgccgcagaacgtg
tcgttcgccgagggcgcgattgtcgagccgctcgcgatcgggctgcaggccgcgaagaaa
gcggcgatgaagccgggcgacatcgcggtcgtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgattctggccgacgtcgtcaag
gagaagctcgcgctgttcgcgtcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgacgcggtcgcgcacgcgaccgacggctggggcgcggacgtcgtgttcgag
gcgagcggcaacgcgaaggcctatgcgggaatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgaaccggtgccgctcgacgtcgtcgcgctgcaggcg
aaggaggcgcggatcgaatcggtgttccgctacgcgaacgtctttccgcgcgcgctcgcg
ctgatcgaatccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system