KEGG   Burkholderia thailandensis 2002721643: BG87_4667Help
Entry
BG87_4667         CDS       T03882                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bthl  Burkholderia thailandensis 2002721643
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BG87_4667 (ahpF)
Enzymes [BR:bthl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BG87_4667 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Glutaredoxin DAO FAD_binding_3 HI0933_like Thi4 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AJY01842
LinkDB All DBs
Position
II:1638515..1640122
Genome map
AA seq 535 aa AA seqDB search
MLDANLKTQLKSYLERITRPVELVASLDDGDKSRELRALLDEIASLSPQVFVVERRDEAE
RAPSFSVGEPGEAARIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDATIEQIRALDGDYT
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVDARRIMAVPTIFLNGET
FGQGRSSVREILAKLDSGASRRAAQALAAKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVTETEGPKFATALEQHVKQYEVDVIDVQRADRLVPGSLHE
IRLASGAVLKAKAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSEVTLIEYGAQLRADEVLQRKLRSLPNVTVLTHARTTELAGDGARL
NALVYEDMRTGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSDADAVQPADADAPASAEVVAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgccaatctcaagactcagttgaaatcgtaccttgaacggatcacgcgtccc
gtcgagctcgtcgcatcgctcgacgacggcgacaagtcgcgcgagctgcgcgcgctgctc
gacgagatcgcgtcgctgtcgccgcaagttttcgtcgtcgagcgccgcgacgaggccgag
cgcgcgccgtcgttctcggtcggcgagccgggcgaagccgcgcgcattcgcttcgccggg
ataccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcaaacgggcggccat
ccggtgaagctcgacgacgcgacgatcgagcaaattcgcgcgctcgacggcgactacacg
ttcgagacgtatatctcgctcacctgtcagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggtgcgttgttccag
gacgaagtcgacgcgcgccggatcatggccgtgccgacgatcttcctgaatggcgagacg
ttcggccagggccgcagcagcgtgagggaaatcctcgcgaagctcgatagcggcgcgagc
cggcgcgcggcgcaggcgctcgcggcaaagcccgtgttcgacatgctgatcgtcggcggc
ggccccgccggcgcggccgccgcgatctacgcggcgcgcaagggcatctcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgacacgatggcgatcgagaatttcgtgtcg
gtgacggaaaccgaagggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gaagtcgacgtgatcgacgtgcagcgcgccgaccggctcgtgccgggcagtctccatgaa
atccgtctcgcgagcggcgcggtgctgaaagcgaaggccgtcgtgctcgccacgggcgcg
cgctggcgggagatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacgggccgcttttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggcggcgatcgatctcgccggcatcgtcagtgaagtgacgctgatc
gaatacggcgcgcaactgcgcgcggacgaggtgctgcaacgcaagctgcgcagcctcccg
aacgtgacggtgctcacgcacgcgcgcacgaccgagctcgcgggcgacggcgcgaggctc
aacgcgctcgtctacgaggacatgcgcacgggcgaaacgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggaacggtcgagctg
tcgaaacacggcgagatcgtcgtcgacgcgcgcggcgcgacgtcggtgcccggggtgttc
gccgccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcgtcgctcggcgcgttcgactacctgatccgaagcgacgcggatgcggtgcag
ccggcggacgccgacgccccggcaagcgccgaagtggtggccgcctga

DBGET integrated database retrieval system