KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_1637
Entry
BTRA_1637         CDS       T03391                                 

Gene name
acpP
Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00998  Biosynthesis of various secondary metabolites - part 2
bthm01100  Metabolic pathways
bthm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTRA_1637 (acpP)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BTRA_1637 (acpP)
SSDB
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493
Other DBs
NCBI-ProteinID: AIC87326
LinkDB
Position
1:1784409..1784648
AA seq 79 aa
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA
EKITTVQQAIDYARANVKA
NT seq 240 nt   +upstreamnt  +downstreamnt
atggacaacatcgaacaacgcgtgaagaagatcgtcgccgagcaactgggcgtcgccgaa
gctgaaatcaagaacgaagcgtcgttcgtgaatgacctcggcgcggactcgctcgacacg
gtcgagctcgtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaagcc
gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system