KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_2229Help
Entry
BTRA_2229         CDS       T03391                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00010  Glycolysis / Gluconeogenesis
bthm00053  Ascorbate and aldarate metabolism
bthm00071  Fatty acid degradation
bthm00280  Valine, leucine and isoleucine degradation
bthm00310  Lysine degradation
bthm00330  Arginine and proline metabolism
bthm00340  Histidine metabolism
bthm00380  Tryptophan metabolism
bthm00410  beta-Alanine metabolism
bthm00561  Glycerolipid metabolism
bthm00620  Pyruvate metabolism
bthm00625  Chloroalkane and chloroalkene degradation
bthm00903  Limonene and pinene degradation
bthm01100  Metabolic pathways
bthm01110  Biosynthesis of secondary metabolites
bthm01120  Microbial metabolism in diverse environments
bthm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTRA_2229
   00053 Ascorbate and aldarate metabolism
    BTRA_2229
   00620 Pyruvate metabolism
    BTRA_2229
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTRA_2229
   00561 Glycerolipid metabolism
    BTRA_2229
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTRA_2229
   00310 Lysine degradation
    BTRA_2229
   00330 Arginine and proline metabolism
    BTRA_2229
   00340 Histidine metabolism
    BTRA_2229
   00380 Tryptophan metabolism
    BTRA_2229
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTRA_2229
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTRA_2229
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTRA_2229
Enzymes [BR:bthm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BTRA_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: AIC85703
LinkDB All DBs
Position
1:2447326..2448762
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWHPSTGKGTIDVIDSGTEAVIGRIPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLRKITDNLKARSEDLAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEPVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEIAPLNAF
ILAEAIHDAELPAGVFNLVCGYGPVVGEALASDPEVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARELAK
AAAESYVAGDPRDDATRLGALASSAQQKRVQDYIRRGIDEGAELVTGGLGMPEGIARGFF
VKPTVFGRVKPDATIAQEEIFGPVLSIITYRDEADAVRIANDSPYGLGGAVWSGSDERAM
RIARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLEEYLEYKSMQLRPKKGA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctatatcggcggcgcgtggcacccgagcacgggcaagggc
acgatcgacgtgatcgactcgggcaccgaggccgtgatcggccgcattcccgaaggcacc
gccgaagacgcgaaagcggccgtcgccgccgcgcgcgcggcgttcgacggctgggcggcg
acgccgcccgccgagcgcgctcgctatctgcgcaagatcaccgacaacctgaaggcgcgc
agcgaggacctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggttggcggtccgatctataactggggcgcgtatgcgaagctcgccgagacg
ttcgcgttcgaggagccggtcggcaattcgctcgtcgtgcgcgagcccgttggtgtcgtc
gcggcgatcacgccatggaactacccgctcaaccagatcacgctgaaggtcgccgccgca
ctcgcggcgggctgcacggtcgcgctgaagccgtcggagatcgcgccgctcaatgcgttc
atcctcgccgaggcgattcatgacgcggagctgcccgccggcgtgttcaatctcgtgtgc
ggttacgggcccgtcgtcggcgaggcgctcgcgagcgatcctgaggtggacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgagctgggcggcaagtcggcctcggtgattctcgacgacgccgacttc
gcggccgcggtgaagggcacggtgtccgcgtgctacctgaacgcgggccagacgtgctcc
gcgcatacgcggatgctcgtgccggaatcgcgctatgaagaagcacgcgagctcgcgaag
gccgccgcggaaagctatgtcgcaggcgatccgcgcgacgacgcgacgcggcttggcgcg
ctcgcgtcgtcggctcagcaaaagcgcgtgcaggattacatccggcgcggcatcgacgag
ggcgccgagctcgtcacgggcggcctcggcatgcccgaaggcatcgcacgcggcttcttc
gtgaagccgaccgtgttcggccgcgtgaagcccgacgcgacgatcgcgcaggaagaaatc
ttcggtccggtgctgtcgatcatcacgtatcgcgacgaggccgacgcggtgaggatcgcg
aacgattcgccgtacggcctcggcggcgcggtgtggtcgggcagcgacgagcgcgcgatg
cgcatcgcgcgccgcattcgcacggggcaggtcgacatcaacggcggagcctggaacatg
gccgcgccgttcggcggtttcaaacagtcggggatcggtcgcgagaacggcgtgtacggg
ctcgaagaatatctcgaatacaaatcgatgcaattgcgaccgaagaagggcgcgtga

DBGET integrated database retrieval system