KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_2390Help
Entry
BTRA_2390         CDS       T03391                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTRA_2390
Enzymes [BR:bthm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BTRA_2390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AIC86287
LinkDB All DBs
Position
1:complement(2671153..2672244)
Genome map
AA seq 363 aa AA seqDB search
MTNRNDDTQQMTAIVCHAPEDYRVERVAKPRANARELVIRIGACGICASDCKCHSGAKMF
WGGPSPWVKAPVIPGHEFFGHVEELGEGAAEHFGVALGDRVIAEQIVPCGNCRYCKSGQY
WMCEVHNIFGFQREVADGGMAEYMRIPSTAIVHRIPLGISLEDAAIIEPLACAIHTVNRG
DIQLDDVVVIAGAGPLGLMMTQVAKLKTPKRLVVIDPVGERLALAREYGADVTIDPTRED
ALAIVHELTGGYGCDVYIETTGVPAGVTQGMSLIRKLGRFVEFSVFGKDTALDWSIIGDR
KELDVRGAHLGPYCYPVAIDLLARGLVTSKGIVTHGFSLEEWDEAIRVANSLGSIKVLMK
PRG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgaaacgacgacacgcagcagatgacggcgatcgtctgccacgcccccgag
gactatcgcgtcgagcgcgtcgcgaagccgcgcgcgaacgcgcgcgagctcgtgatccgc
atcggcgcgtgcggaatctgcgcgagcgactgcaagtgccattccggcgcgaagatgttc
tggggcggcccgagcccgtgggtcaaggcgcccgtgattcccggccacgagttcttcggc
catgtcgaggaactgggcgagggcgcggccgagcacttcggcgtcgcgctcggcgatcgc
gtgatcgccgagcagatcgtgccgtgcggcaattgccgctactgcaagtcgggccagtac
tggatgtgcgaggtccacaacatcttcggcttccagcgagaagtcgccgacggcgggatg
gccgagtacatgcggattccgtccaccgcgatcgtccaccggattccgctcggcatctcg
ctcgaggacgcggcgatcatcgagccgctcgcgtgcgcgatccacacggtcaatcgcggc
gacatccagctcgacgacgtcgtcgtgatcgcgggcgcggggccgctcggcctgatgatg
acgcaggtcgcgaagctgaagacgccgaagcggctcgtcgtgatcgatcccgtcggcgaa
cggctcgcgctcgcgcgcgaatacggcgcggacgtgacgatcgacccgacgcgcgaggac
gcgctcgcgatcgtgcacgagctgacgggcggctacggctgcgacgtctacatcgagacg
accggcgtgccggcgggcgtcacgcaggggatgagcctgatccgcaagctcggccgcttc
gtcgagttctcggtgttcggcaaggacacggcgctcgactggtcgatcatcggcgatcgc
aaggagctcgacgtgcgcggcgcgcatctcggcccgtattgctatcctgtcgcgatcgat
ctgctcgcgcgcgggctcgtcacgtcgaagggcatcgtcacgcacggcttctcgctcgaa
gaatgggacgaggcgatccgggtcgcgaactcgctcggctcgatcaaggtgctgatgaag
ccgcgcggctga

DBGET integrated database retrieval system