KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_2443Help
Entry
BTRA_2443         CDS       T03391                                 

Gene name
nodI
Definition
(GenBank) nodulation ABC transporter NodI
  KO
K09695  lipooligosaccharide transport system ATP-binding protein
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTRA_2443 (nodI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bthm02000]
    BTRA_2443 (nodI)
Transporters [BR:bthm02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipooligosaccharide transporter
    BTRA_2443 (nodI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_22 AAA_23 Gag_p12 AAA_29
Motif
Other DBs
NCBI-ProteinID: AIC85906
LinkDB All DBs
Position
1:2733600..2734514
Genome map
AA seq 304 aa AA seqDB search
MSVAPIDFQQVEKRYDDKLVVDGLSFHVQPGECFGLLGPNGAGKTTALKMLLGITHPDAG
SISLCGEPVPSRARHARRRVGVVPQFDNLDPDFTVRENLLVFARYFGLAAHEARALVPPL
LEFAKLENKADAKVGELSGGMKRRLTLARALVNNPDVLVLDEPTTGLDPQARHLMWERLR
SLLVRGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGAPRTLIESEIGCDVIEIYGPDP
AQLREELAPFAERTEISGETLFCYVDDPEPVNARLKGRAGLRYLHRPANLEDVFLRLTGR
EMQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgcacccatcgattttcaacaagtcgagaaacgctacgatgacaagctcgtc
gtggacggcttgtcgtttcatgtgcagcccggcgaatgcttcggcctgctcggcccgaac
ggcgccggcaagacgacggcgctcaagatgctgctcggcatcacgcatcccgacgcgggt
tcgatcagcctgtgcggcgagcccgtgccgtcccgcgcgcggcacgcgcggcggcgcgtc
ggcgtcgtgccgcaattcgacaacctcgaccccgacttcaccgttcgcgagaacctgctc
gtgttcgcccgctacttcggactcgctgcgcacgaagcgcgcgcgctcgtgcctccgctg
ctcgagttcgcgaaactcgaaaacaaggcggatgcgaaagtgggcgagctgtcgggcggg
atgaagcggcggctcacgctcgcgcgggcgctcgtcaacaatcccgacgtgctcgtgctc
gacgagccgacgacgggcctcgatccgcaagcccggcatctgatgtgggagcggctgcgc
tcgcttctcgttcgcggcaagacgatcctgctcaccacgcacttcatggaagaggccgag
cgcctgtgccaccgcctgtgcgtgatcgaggaaggccgcaagatcgcggaaggcgcgccg
cgcacgctgatcgaatcggagatcggctgcgacgtgatcgagatctacgggcccgatccc
gcgcagcttcgcgaggagctcgcgccgttcgccgagcgaaccgagatcagcggcgaaacg
ctcttttgctacgtcgacgatccggagccggtcaacgcgcgcctgaagggccgcgccggt
ctgcgctatctgcaccgccccgcgaatctcgaagatgtattcctgcggctgacgggtcgc
gagatgcaggattga

DBGET integrated database retrieval system