KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_3273Help
Entry
BTRA_3273         CDS       T03391                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Brite
Enzymes [BR:bthm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BTRA_3273 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIC86431
LinkDB All DBs
Position
1:complement(3638401..3638979)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISQETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgttgccgtacgctgaagacgccctcgctccgcacatctcg
caggagacgatccagtatcactacggcaagcatcaccaggcttatgtgacgaacctgaac
aacctgatccccggcaccgagttcgagaacctgtcgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcaaatctggaatcacacgttcttctggaacagc
ctgtctccgaacggcggcggcgcgccgactggcgcgctcggcgacgcgatcaacgcgaag
tggggctcgttcgacgcgttcaaggaagcgttcacgaaggcggcggtcggcacgttcggc
tcgggctgggcgtggctcgtgaagaaggcggacggctcgctcgacatcgtgtcgacgagc
aacgcggccacgccgctcacgacggccgacaagccgctcgtcacgatcgacgtgtgggag
cacgcttactacatcgattaccgcaacgcgcgtccgaagttcgtcgaagcgttctggaac
atcgtgaactgggatttcgccgcgaagaacttcgcataa

DBGET integrated database retrieval system