KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_3627
Entry
BTRA_3627         CDS       T03391                                 

Definition
(GenBank) phosphopantetheine attachment site family protein
  KO
K02078  acyl carrier protein
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00998  Biosynthesis of various secondary metabolites - part 2
bthm01100  Metabolic pathways
bthm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTRA_3627
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BTRA_3627
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-ProteinID: AIC90423
LinkDB
Position
2:190609..190890
AA seq 93 aa
MTAGPQLSDAAALAAAKTLLAGMLGVPEAHIAPQQRLLDDLAMDSLELIELAMELDERWN
IRLDRTRLAEVATVADVAALLGAAARPDDSGGA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgacggccggcccgcaactaagcgacgccgccgcgctcgcggcggcgaagacgctgctg
gccggcatgctcggcgtgccggaagcgcacatcgcaccgcagcagcggctgctcgatgac
ctggcgatggattcgctcgagctgatcgaactcgcgatggaactcgacgagcgctggaac
atccgtctcgatcgcacgcggcttgccgaagtcgcaacggtggcggatgtcgccgcgctg
ctcggcgcggccgcgcgcccggacgattcgggaggcgcatga

DBGET integrated database retrieval system