KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_4580Help
Entry
BTRA_4580         CDS       T03391                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00440  Phosphonate and phosphinate metabolism
bthm01100  Metabolic pathways
bthm01120  Microbial metabolism in diverse environments
bthm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTRA_4580 (aepX)
Enzymes [BR:bthm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTRA_4580 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD
Motif
Other DBs
NCBI-ProteinID: AIC89547
LinkDB All DBs
Position
2:1432068..1433756
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSQSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ADAYAEAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDAFRQAGISTV
IWANHLIRASASAMQAVAREIQESETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAALVLAASRGNGLEAVTGDKPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIVSYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKVHLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLKARDDFDSLDLPALLNALVDAGERIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNTGNGGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagccagtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtggtggacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctggggaatggacgaggcgctgcgccgc
gcggacgcttacgcggaagcgggtgccgacgcgatcctgattcacagcaagctgtcgcgg
cccgacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgcattccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcatccgcttccgcgatgcaggcggtcgcgcgcgaa
atccaggaaagcgaaacgctcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcggatctacctgtcgtcgagc
tcgcgcgcgtcgaacgcggcgctcgtgctcgcggcgagccgcggcaacgggctcgaggcc
gtcaccggggacaagccgaaggtgatgctgccgatcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggttatcgc
gccgatgcgatcgacacgtccggcgtgaaactcgtcgtcaacgagcggcacgcgcaaacc
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctcacgggcgacaccatcgtctcg
tacggcgatctgctgttccgcagctacatcctgcgcgacctcgccgagagcgaggccgag
ttcagcgtcgtcgtcgattcctcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaagtgcatttgcgccgc
gtgtcgagcgatgcgagcgaagccgcgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggcacgctgaaggcgcgcgacgat
ttcgattcgctcgatctgccggccctcctgaacgcgctcgtcgacgcgggcgagcggatc
gaggtgcaatacgtgcacggccactggcgaggcgtcaacgatctcgacgatttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacacgggcaacgggggc
gcgcgatga

DBGET integrated database retrieval system