KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_4581
Entry
BTRA_4581         CDS       T03391                                 

Gene name
aepY
Definition
(GenBank) phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00440  Phosphonate and phosphinate metabolism
bthm00998  Biosynthesis of various secondary metabolites - part 2
bthm01100  Metabolic pathways
bthm01110  Biosynthesis of secondary metabolites
bthm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTRA_4581 (aepY)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BTRA_4581 (aepY)
Enzymes [BR:bthm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     BTRA_4581 (aepY)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Other DBs
NCBI-ProteinID: AIC90385
LinkDB
Position
2:1433753..1434934
AA seq 393 aa
MIEAAQFVEAARERGFDWYAGVPCSYLTPFINYVLQDPALHYVSAANEGDAVALVAGATL
GGRRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVPDEPQHALMGPITPAM
LDTMEIPWETFPTQAGAIAPALDRAIAHMDATGRPYALVMQKGSVAPYALDHAAMPERRA
HAAARATPRAASPSAWPTRHDALARIVARTPADSTVVLASTGFCGRELYALDDRPNQLYM
VGSMGCVTPLALGLALARPDLTVVALDGDGAALMRMGAFATLGAYGPSNLVHLLLDNGAH
ESTGGQATVSQYVSFAGVAAACGYATALEGDDLGVLDAALDAARAGAHALPHGGAHFARL
SIRPGVPDGLPRPTVTPVDVKTRLMRHIGATPA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgatcgaagccgcgcagttcgtcgaggcggcgcgcgagcgcggcttcgactggtacgcg
ggcgtgccctgctcgtacctgacgccgttcatcaattacgtgctgcaggacccggcgctc
cattacgtgtcggcggcgaacgagggcgatgcggtcgcgctcgtcgcgggcgcgacgctc
ggcggccggcgcgggatcgcgatgatgcagaactcggggctcggcaacgcggtgagcccg
ctcacgtcgctcacgtggacgttccgtctgccgcagctcctgatcgtcacgtggcgcggc
cagcctggcgtgcccgacgagccgcagcacgcgctgatgggcccgatcacgcccgcgatg
ctcgacacgatggaaatcccgtgggaaacgttcccgacgcaagccggcgcgatcgccccg
gcgctcgaccgcgcgatcgcgcacatggacgcgacgggccgcccgtacgcgctcgtgatg
cagaaaggcagcgtcgcgccgtacgcgctcgatcatgcggcgatgcccgagcgccgcgcg
cacgccgccgcgcgcgcgacgccgcgcgccgcttcaccctcggcatggccaacgcgccat
gacgcgctcgcgcgaatcgtcgcgcgcacgccggccgattcgacggtcgtgctcgcctcg
acgggtttctgcggccgcgagctgtacgcgctcgacgatcgtccgaaccagctctacatg
gtcggctcgatgggctgcgtgacgccgctcgcgctcggcctcgcgctcgcgcggccggac
ctgaccgtcgtcgcgctcgacggcgacggcgccgcgctgatgcgcatgggcgcgttcgcg
acgctcggcgcgtacgggccgtcgaacctcgtgcatctgctgctcgacaacggcgcgcac
gaatcgacgggcggccaggcgacggtgtcgcaatacgtgtcgttcgcgggcgtcgcggcc
gcgtgcggctacgccacggcgctcgaaggcgacgacctcggcgtgctcgacgcggcgctc
gatgcggcgcgcgcgggcgcgcacgcgctcccgcacggcggcgcgcacttcgcgcgcctg
tcgatccgcccgggcgtgcccgacggcctgccccgcccgacggtgacgcccgtcgacgtg
aaaacgcgcctgatgcgccacatcggcgcgacgccggcctga

DBGET integrated database retrieval system