KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_4720
Entry
BTRA_4720         CDS       T03391                                 

Gene name
phnY
Definition
(GenBank) putative phosphonoacetaldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00440  Phosphonate and phosphinate metabolism
bthm01100  Metabolic pathways
bthm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTRA_4720 (phnY)
Enzymes [BR:bthm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BTRA_4720 (phnY)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AIC90928
LinkDB
Position
2:complement(1614944..1616398)
AA seq 484 aa
MTPPPLRDHPAYRRETLRWCGQRAARARTLDVFDPYSGRRVGTVPLATVDDVRRAFDYAG
AYRPTLSRYERSQILERAAARLVACAEEASTLISLESGLSKQDSRYEIGRVADVFKFASI
EALRDDAQSYSCDLTPHGTSRRVFSQRQPLDGVIVAITPFNHPMNQVAHKIAPAIATNNR
VIVKPSEKVPLSALYLADVLYEAGLPEPMLQVLTGDPREIADELLTHPSAALITFTGGVA
IGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAATLAAQGSYKNSGQRCTAVKRILVQ
KRVAPRFTELLVEHTRAWTYGDPFDPTNRMGTVIDEAAAALFEARVDEAVARGARLLTGN
ARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDAIRISNGTAFGLSSGVCTD
RADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLKTFS
LPWA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgacgccgccgccgcttcgcgatcaccccgcttaccgccgcgagacgctgcgctggtgc
gggcaacgggcggcgcgcgcgcgcacgctcgacgtattcgacccgtattcggggcggcgc
gtcggcacggtgccgcttgcgacggtcgacgacgtgcgccgcgcgttcgactatgcgggc
gcgtaccggccgacgctgtcgcgctacgagcgctcgcagatactcgagcgcgcggccgcg
cgcctcgttgcctgcgcggaagaggcgtccacgctgatctcgctcgaatcgggcctgtcg
aaacaggattcgcgttacgagatcggccgcgtcgcggacgtgttcaagttcgcgtcgatc
gaggcgttgcgcgacgacgcgcagagctattcgtgcgatctgacgccgcacggcacgtcg
cgccgcgtgttctcgcagcggcagccgctcgacggcgtgatcgtcgcgatcacgccgttc
aatcatccgatgaaccaggtcgcgcacaagatcgcgccggcgatcgcgacgaacaatcgc
gtgatcgtgaagccgtcggagaaggtgccgctgtcggcgctgtatctcgccgacgtgctg
tacgaagcgggcctgcccgagccgatgctgcaggtgctgacgggcgatccgcgcgaaatc
gcggacgaactgctgacgcacccgagcgcggcgctgatcacgttcacgggcggcgtcgcg
atcggcaagtccatcgcggcgaaggccggctaccggcgcatcgtgcttgagctgggcggc
aacgatccgctgatcgtgctcgacgacgccgacctcgaacgcgcggcgacgctcgccgcg
cagggctcgtacaagaattccggccagcgctgcacggcggtcaagcgcatcctcgtgcag
aagcgcgtcgcgccacgcttcacggagttgctcgtcgagcacacgcgcgcgtggacgtac
ggcgatccgttcgacccgacgaaccggatggggacggtgatcgacgaggcggcggccgcg
ctgttcgaggcgcgcgtcgacgaagcggtggcgcggggcgcgcgcctgctgacaggcaac
gcgcggcgcggcgcgctgtatgcgccgacggtgcttgatcgcgtcgacgcatcgatgacg
ctcgtgcgcgaggagacgttcgggcccgtgtcgccgatcatcgcgttcgacacgatcgac
gacgcgatccggatcagcaacggcaccgcgttcggcctgtcgtcgggcgtgtgcacggac
cgcgcggatgcgatcgtgcgcttcgtcaacgagctgaacgtcggcacggtaaacgtgtgg
gaggtgccgggctaccggcttgagctgacgccgttcggcggcatcaaggattccgggctc
ggatacaaggaaggggtgcaggaggcgatgaagagcttcacgaacctgaagacattctcc
ctgccgtgggcgtga

DBGET integrated database retrieval system