KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_4721
Entry
BTRA_4721         CDS       T03391                                 

Gene name
phnA
Definition
(GenBank) phosphonoacetate hydrolase
  KO
K19670  phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00440  Phosphonate and phosphinate metabolism
bthm01100  Metabolic pathways
bthm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTRA_4721 (phnA)
Enzymes [BR:bthm01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     BTRA_4721 (phnA)
SSDB
Motif
Pfam: Phosphodiest
Other DBs
NCBI-ProteinID: AIC90935
LinkDB
Position
2:complement(1616395..1617636)
AA seq 413 aa
MNRHIEVNGRAYRMPAEPTVAVCVDGCEYDYLEQAANAGVAPFIARMLREGSAFDADCVI
PSFTNPNNLSIVCGAPPSVHGICGNFFWDPDAQRGAGAAVMMNDPAYLRAGTLLAAAADA
GAKVAVVTAKDKLRRLLGWRMRGVCFSAEKANQANLGENGIADVLDFVGLPSPDVYSAAL
SEFVLAAGVRLAQNRRADLMYLSTTDYVQHKCAPGSDGANAFYAMMDRYLAALDALGWVI
GVTADHGMNAKHDPRTGEPNVVYLQDALDAWLGPRRARVILPITDPYVVHHGALGSFATI
YVEEGVDAAAVIGRLSAIDGIELALDNATAAERFELPADRIGDVVAVGRRDVALGTRESE
HDLSGLTVPLRSHGGLSEQRVPLLFNRRIEGVEPGRRLRNFDLFDLALNRAVR
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaatcgacacatcgaagtcaacggccgcgcctaccggatgccggccgagccgacggtg
gccgtctgcgtcgacggctgcgaatacgattacctcgaacaggccgcgaacgcgggcgtc
gcgccgttcatcgcgcggatgctgcgcgagggctcggcgttcgacgccgactgcgtgatc
ccgtcgttcacgaacccgaacaacctgtcgatcgtgtgcggcgcgccgccgtcggtgcac
ggcatctgcgggaacttcttctgggacccggacgcgcagcgcggcgcgggcgctgcggtg
atgatgaacgaccccgcgtacctgcgcgcgggcacgctactcgccgcggcggcggacgcg
ggcgcgaaggtggccgtcgtgacggcgaaggacaagctgcgccggttgctcggctggcgg
atgcgcggcgtgtgcttctcggcggagaaggcgaatcaggcgaacctcggcgagaacggc
atcgccgacgtgctcgatttcgtcggcttgccgtcgcccgacgtctacagcgcggcgctg
tcggaattcgtgctcgcggcgggcgtgcggctcgcgcagaaccggcgcgcggacctgatg
tacctgtcgacgaccgattacgtgcagcacaagtgcgcgccgggcagcgacggcgcgaac
gcgttctacgcgatgatggaccgctacctcgcggcgctcgatgcgctcggctgggtgatc
ggcgtgaccgccgatcatgggatgaacgcgaagcacgatccccgcacgggcgagccgaac
gtcgtctatctgcaggacgcgctcgacgcgtggctcgggccgcgccgcgcgcgcgtgatc
ctgccgatcaccgatccctacgtcgtccatcacggcgcgctcggctcgttcgcgacgatc
tacgtcgaggaaggcgtcgacgcggccgcagtgatcggccggctgagcgcgatcgacggc
atcgaactcgcgctcgacaacgcgacggcggccgagcgcttcgagctgccggccgaccgg
atcggcgatgtcgtcgccgtgggccggcgcgatgtcgcgctcggcacgcgagagagcgag
cacgacctgtcggggctgacggtgccgctgcgctcgcacggcggcctgtcagagcagcgc
gtgccgctgttgttcaatcgccggatcgagggcgtcgagccaggccgccggctgcgcaac
ttcgatctgttcgacctcgcgctgaaccgggccgtgcgatga

DBGET integrated database retrieval system