KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_4726
Entry
BTRA_4726         CDS       T03391                                 

Gene name
phnW
Definition
(GenBank) 2-aminoethylphosphonate--pyruvate transaminase
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00440  Phosphonate and phosphinate metabolism
bthm01100  Metabolic pathways
bthm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTRA_4726 (phnW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bthm01007]
    BTRA_4726 (phnW)
Enzymes [BR:bthm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BTRA_4726 (phnW)
Amino acid related enzymes [BR:bthm01007]
 Aminotransferase (transaminase)
  Class V
   BTRA_4726 (phnW)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2 UPF0020
Other DBs
NCBI-ProteinID: AIC89566
LinkDB
Position
2:1621982..1623091
AA seq 369 aa
MPERDPILLTPGPLTTSRMTRDAMLHDWGSWDAAFNRLTKSVCADLVRIAGGGDAYVCVP
LQGSGTFAVEAALGTLVPRDGRVLVPNNGAYCARIAKILRRLGIAHSELPFAEDEPASAQ
AIDAALARDARITHVALVHLETSAGLLNPLDDIAAVCRARGKALIVDAMSSFGALPIALA
GSGIDALISASGKCLEGVPGMGFVIARRAPLEAAEGRSPSVVLDLHDQYAYMQRTSQWRF
TPPTHVLAALRAALDQFFDEGGQPARGARYAENCAALVDGMRALGFEPFLDARAQASVIV
TFHAPADPAYAFAAFYAAVRDAGYVLYPGKLTTADTFRVGCIGALGAHEMRGAVAAIGGA
LRALGIAMR
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccagaacgtgatcccatcctgttgacgcccggcccgctgacgacatcgcgcatgacg
cgcgatgcgatgctgcatgactggggctcgtgggacgccgctttcaaccggctgacgaag
agcgtctgcgccgatctcgtgcggatcgcgggcggcggcgacgcatacgtctgcgtgccg
ctgcaaggcagcggcacgttcgccgtcgaggcggcgctcggcacgctcgtgccgcgcgac
ggccgcgtgctcgtgccgaacaacggcgcgtattgcgcgcggatcgcgaagatcctgcgc
cggctcggcatcgcgcacagcgaactgccgttcgccgaggacgagccggcgagcgcgcag
gcgatcgacgcggcgctcgcgcgcgacgcgcggatcacgcatgtcgcgctcgtgcatctc
gaaacgagcgccggcctgctgaacccgctcgacgacatcgccgccgtctgccgcgcgcgc
ggcaaggcgctgatcgtcgatgcgatgagctcgttcggcgcgctgccgatcgcgctcgcg
ggcagcggcatcgacgcgctgatctcggcgagcggcaagtgtctcgaaggggtgcccggc
atgggcttcgtgatcgcgcggcgcgcgccgctcgaggcggccgaggggcgctcgccgtcg
gtggtgctcgatctgcacgaccagtacgcgtacatgcagcgcacgtcgcaatggcgcttc
acgccgccgacgcacgtgctcgccgcgctgcgcgccgcgctcgaccagttcttcgacgag
ggcggacagccggcgcgcggcgcacgctacgcggagaactgcgcggcactcgtcgacggc
atgcgcgcgctcggcttcgagccgtttctcgacgcgcgcgcgcaggcgagcgtgatcgtc
acgtttcacgcgcccgccgatcccgcgtatgcgttcgccgcgttctacgcggccgtgcgc
gacgcgggctacgtgctgtatccgggcaagctgacgacggccgacacgtttcgcgtcggc
tgcatcggcgcgctcggggcgcacgagatgcgcggcgcggtggcggcgatcggcggcgcg
ctgagagcgctcgggatcgcgatgcggtga

DBGET integrated database retrieval system