KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_634Help
Entry
BTRA_634          CDS       T03391                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00010  Glycolysis / Gluconeogenesis
bthm00620  Pyruvate metabolism
bthm01100  Metabolic pathways
bthm01110  Biosynthesis of secondary metabolites
bthm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTRA_634 (acoD)
   00620 Pyruvate metabolism
    BTRA_634 (acoD)
Enzymes [BR:bthm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BTRA_634 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AIC87075
LinkDB All DBs
Position
1:717479..718999
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPIGGEYFDNVSPVTGRPFTAIPRSREADVEL
ALDAAHAAKAGWAATDAAQRANVLLRIADRMEANLARLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAIKRVEAIKQGHPLDSQTMIGAQASSEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEAL
EIANDTQYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaatttccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccgatcggcggtgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgaagccgacgtcgagctc
gcgctcgacgccgcgcacgcggcaaaggcgggctgggccgcgacggacgcggcccagcgc
gcgaacgtgctgctgaggatcgccgatcggatggaggcgaacctcgcgcgcctcgcggtc
gccgagacgatcgacaacggcaagccgctgcgcgagacgaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gacatcggcggcgacatggtcgcctatcacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaactttccgctcctgatggccgcgtggaagctcgcgcccgcgctcgcg
gccggcaactgcgtcgtgctcaagcccgccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggc
ctcgaagcgggcaagccgctcgcgtcgagcaagcgaatcgcgaagatcgcgttcacggga
gagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctgattcccgtcacg
ctcgagctcggcggcaagagtccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgcacgtgcccgtcgcgcgcgctcgtcgaggagagcatctacgagcgcttcatcgagcgt
gcgatcaagcgcgtcgaggcgatcaagcaaggccatccgctcgattcgcagacgatgatc
ggcgcgcaggcgtcgtccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgagggcgcgcaatgcctgacgggcggcgagcgcaacgtgctcggcggcgaactcgcc
gaaggctactacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagagattttcgggccggtgctcgcggtgacgacgttcaagaccgaagaggaagcgctc
gagatcgcgaacgacacgcagtacggcctgggcgcgggcgtctggacgcgcgacggcaac
cgcgcgtaccgcttcggccgcggcatccaggccggccgcgtgtggaccaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcaatcgggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system