KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_00261Help
Entry
Btheta7330_00261  CDS       T04540                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
btho  Bacteroides thetaiotaomicron 7330
Brite
KEGG Orthology (KO) [BR:btho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Btheta7330_00261 (ahpF)
Enzymes [BR:btho01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Btheta7330_00261 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored HI0933_like FAD_binding_2 Thioredoxin_3 Thi4 AlaDh_PNT_C DAO NAD_binding_7 NAD_binding_8 FAD_binding_3 PALP Glutaredoxin Lycopene_cycl PLD_C K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALJ39860
UniProt: A0A0P0FHX5
LinkDB All DBs
Position
399897..401450
Genome map
AA seq 517 aa AA seqDB search
MLEPALKEQLKGIFAGLEADFTFDISVSASHESRAELLELLSDVAECSDHITCMVNEGSG
LKFTIGKNGKPTEITFRAIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKALKGPIHL
VTYVSLTCTNCPDVVQALNAMTTLNPSITHEMVDGALYQDEVDALKIQGVPSVFADGKLL
HVGRGEFGELLAKLEAQYGIDETKVETEVKEYDVIVAGGGPAGVSAAIYSARKGLRVAIV
AERVGGQVKETVGIENLISVPETTGSELADNLKTHLLRYPVDLLEQRKIEKVELAGKDKL
VTTSVGEKFIAPALIIATGASWRKLNVPGENDYIGRGVAFCPHCDGPFYKGKQVAVVGGG
NSGIEAAIDLAGICSKVTVFEFMDELKADNVLQERLKSLPNVEVFVSSQTTEVIGNGDKL
TALRIKDRKTEEERLVELDGVFVQIGLSANSSVFRDIVETNRPGEIVIDAHCRTNVTGIY
AAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGLIV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacctgcattaaaagaacaactgaagggtatttttgccggactggaggctgac
tttacctttgatatatccgtatcagccagtcatgaaagccgtgccgaattgctggaattg
ctgagcgatgtagccgaatgttccgatcacatcacttgtatggtaaatgaaggaagcgga
cttaaatttacgataggaaagaatggtaaacctacagaaattactttccgtgctatcccc
aacggacatgagtttacttctttattactcgccatcctgaatctggacggtaagggaaag
aattttccggatgaggctgtctgcaaccgtgtgaaagccttgaagggtccgatacactta
gtgacctatgtctcactgacttgcaccaactgtccggatgtagttcaggcattgaatgca
atgaccacactgaatccttccattactcatgaaatggttgacggtgcactgtatcaggat
gaagtggatgccttgaagatacaaggcgtgccttctgtatttgccgatgggaaactgctt
catgtaggtcgtggcgaatttggcgaattgcttgctaaactggaagcgcaatacggtatt
gatgaaaccaaggtggagacggaagtgaaggaatacgatgttatcgtagccggtggcggt
cctgccggagtatcagcagccatctattctgcccgtaaaggcttgcgcgtggcgattgtt
gccgagcgtgtcggcggacaggtgaaagagacggtaggcattgagaatctgatttcggtt
cccgaaacaacaggaagcgaacttgccgataatctgaaaacgcatcttctgcgttatcct
gttgatttgttggaacagcgtaagatagaaaaggtagaacttgccggaaaagataaactg
gtaactacttccgtaggagagaaattcattgctcctgcattgattatcgctacaggtgca
agctggcgaaaactgaatgttcccggcgagaacgattatatcgggcgtggagtcgctttc
tgtcctcattgcgacggtcctttctataaaggaaagcaggttgcggtagtgggcggtgga
aactccggcatcgaggcagccattgacttggcaggtatctgttctaaagtcaccgtcttt
gaatttatggatgaactgaaagcggataatgtccttcaggaaagacttaaatctctgccg
aatgtggaagtattcgtgagttcgcaaacgacagaagtaattggtaatggcgataaactg
acagccttgcgcatcaaagaccgtaagacggaagaagaacgtttggtagaactggacgga
gtattcgtgcagatcggactttccgccaatagcagcgttttccgtgatattgtggaaaca
aaccgaccgggtgaaatcgttatcgatgcgcattgccgtaccaatgtgacgggaatctat
gcagccggagacgtatcgaccgtaccttacaaacagattattatttctatgggcgaaggt
gccaaagccgccctttctgcctttgatgaccgcgtgcgggggctgattgtataa

DBGET integrated database retrieval system